DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and tjp1

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_017947903.1 Gene:tjp1 XenbaseID:XB-GENE-490684 Length:1324 Species:Xenopus tropicalis

Alignment Length:1817 Identity:466/1818 (26%)
Similarity:699/1818 (38%) Gaps:554/1818 (30%)


  Fly   634 RFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAVLFL 698
            :.:.|:|..|||:||.|||:.||||..|...|||:.:||..||:||:||::|...:.||||||||
 Frog     7 KLVKFRKGDSVGLRLAGGNDVGIFVAGVLDDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFL 71

  Fly   699 LSLQ--DRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGEMAFKAGDVFRVIDTLHNG 761
            |.|.  :.:.::.|..|:.|..:|.:..||||:|:|||..:..|...::|..|:||||:|||:||
 Frog    72 LDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNG 136

  Fly   762 VVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNANESRGNFFRRRRSTHRRSKS 826
            .:|||..::|||.|:|::||:||||:|||:||:.|:...|   .|...|.:|:|.|..  |.||.
 Frog   137 KLGSWLAIRIGRNHKEVERGIIPNKNRAEQLASVQYTLPK---TAGGDRADFWRFRGL--RSSKR 196

  Fly   827 LSRENWDDVVFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFPDKFSTPLQDDD 891
            ..|::.:|:......:|||||||||||..||:||||:|||::|:|||:||::.||.:.....:..
 Frog   197 NLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVVIFGPIADVAREKLAREEPDIYEVARSEPR 261

  Fly   892 KSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKHVIKQLRHG 956
            .:........|:||..|:.::||.||||||:||||||||||||:||:|:||..|||..:|.:|..
 Frog   262 DAGTDQRSSGIIRLHTIKQIIDRDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMR 326

  Fly   957 LPKAAHKSSKKLLEQCQKLERVWSHIFSTQIAL-SDEESWYRKLRDSIDLQQSGAVWMSESKPVE 1020
            |...:.||::||.|:..||.:...|:|:|.|.| |..:.||..|:::...||:..||:||.|...
 Frog   327 LCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGGLKEAAQQQQNQLVWVSEGKAEG 391

  Fly  1021 SLSDDFLFPMTTSRLSYASSPESDLELSPGPSASLSLGNLPQLVKASSDPSIATNQDNLDRDRDI 1085
            ...||  ..:...||||.|:|.|:..:                  .|:|....::.::.|.    
 Frog   392 GTDDD--LDLHDDRLSYLSAPGSEYSM------------------YSTDSRHTSDYEDTDT---- 432

  Fly  1086 IGEGLPPPYTVPYDHAVPANPNRRQTMDSSKYSIYGTNVPPQ-----QQQPGVGGDTAAVRPQSL 1145
              ||  ..||             .|.:|.:.....||  ||:     ..:| |..||:.::....
 Frog   433 --EG--GAYT-------------DQDLDETLNDEAGT--PPESAITRSSEP-VREDTSGMQENPA 477

  Fly  1146 YGINAPDLPPR-IDRQSKPG--DIPLNTSGSSSRNGTLGRSAQERLFGKAVVQDDVQAEYITRNA 1207
            |    |..||: |.|...||  ::|                :|::                    
 Frog   478 Y----PTYPPQPILRTDSPGYKNVP----------------SQQK-------------------- 502

  Fly  1208 LVGSGAAETLDRQQQQQQQTHASLERQARLNAQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAM 1272
                  ||.|.                                  |:.|.||||..::..:..|:
 Frog   503 ------AEALP----------------------------------AAPYLSVSSETNHTTSTAAV 527

  Fly  1273 QNLGRLGPNAPDDLKSVPNANGRPLPPTGQSHEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMN 1337
            ..:|.|       |:|         |.|..:|...|...       |:.|..|....:.:     
 Frog   528 NPMGGL-------LRS---------PSTEAAHIILRDQE-------PSSLPVQIDSAKVY----- 564

  Fly  1338 ASRNIDPRNGTPQRPSNLGLESSPRKPLVETKTDYG-KYSRNNSVTQADYTKLPKTAPHGVVPPP 1401
                         |.....:|.:||:..:..:...| :..|:...|..:|..:|..|        
 Frog   565 -------------RKEAYAMEENPRQNYLMKQQVLGHQIQRHEKETNLNYDGVPAYA-------- 608

  Fly  1402 NVSNGQGQMNGSGTPSSNGSGPFKPVPPPKPKNYRPPVQSGGSSGSGGTTPWENGDSGSPRSPNG 1466
                                        .||.| |...||                         
 Frog   609 ----------------------------EKPLN-REYDQS------------------------- 619

  Fly  1467 FYYPPTPSH-----HHYGQQATPGSPSNGHMQPPPPQQQQPTYGGSNGNYGQAPPPQSYPQANGY 1526
            :.|..|..:     |:|..:..    .:.|:         |||....|.|..   .|||||...:
 Frog   620 YCYDSTSDYVDQFPHNYDSRIN----FDDHV---------PTYDEQWGYYDD---KQSYPQRPPF 668

  Fly  1527 NGNGH-------HYNGGSGTGPYIAPHRGMPPPIGNLPPHTPERHALDLAGSREQRGSAFELYRK 1584
            :...:       |.:.......:..|....|||:                 :.:.|....:.|:.
 Frog   669 DSKRNRDFNIRQHSDENLERNYFQQPRLEEPPPV-----------------AYDNRPRPSQNYKP 716

  Fly  1585 PQIGATAGHHHNMSEMEPYD--ERYDDYYNMPPPAAHPSQGHHMQRSRSAPRYPHERPPHAQDPN 1647
            .|:      |:..|....||  .||     .|.|...||    :..|:|:...|           
 Frog   717 TQV------HYEDSTTAEYDMHMRY-----KPEPQTIPS----VPTSKSSDAKP----------- 755

  Fly  1648 YYGHYGTSRGHSQPRQQYSQHHQQQYYDDHGLEMGPPPLPPHKKKKSVLKSPLVALKNALLKSTR 1712
            |:..:  .||:.....|.......||.....:|..||  ||.:.|..:|.:           |::
 Frog   756 YFDQH--IRGYEHSPTQVFNTKPGQYDTSPRMEAMPP--PPVQSKPELLST-----------SSK 805

  Fly  1713 PLRRMNSMVEP---ERKPKGLRRQQSMLERGVQRPYYPDEYPTYPAGFEERAHGGQGMMQPHSQD 1774
            ||......|.|   |.......:.||:|.|               ....|.....||.......|
 Frog   806 PLPAPAPSVAPAATEEDDDPAMKPQSVLTR---------------VKMFENKRSNQGEKNKDIND 855

  Fly  1775 AYYQRGGHYAPQQQEMMNSTYQNLEGEDIYGNIGNTVPRMPHHQDNGYGYDQYDLYANRACIDLE 1839
            :...:....||                                                      
 Frog   856 STLVKAPDVAP------------------------------------------------------ 866

  Fly  1840 RRQAEAAAASGGRNGRRIVRRHSTTTADRGGNPGPPRRPMISPGYEQDPQEIYQTRNGAYMLPDQ 1904
                           :.|:.:.|.|.|          .|:  |.|:||        ...|.:|:.
 Frog   867 ---------------KPILNQVSATKA----------APV--PHYDQD--------KATYRVPEP 896

  Fly  1905 RR---APSSEVMTRRRFYPGAANEQTEEEPLYQSRREMQRE---MQRNHLYQSKREMQERISQGK 1963
            ::   .|..:::....:.|....|...::..|..||..::.   :..|.|.:..:..|       
 Frog   897 QKPQVKPPEDIIRANHYDPDEDEEYYRKQLSYFDRRSFEKPTPLLSGNILPEPAKPAQ------- 954

  Fly  1964 RDMEREFSPQSSSSQSEAS-NSEAIYQSRREAKESALKTRSQLRDQIYQTRREALDSMAEPIYVS 2027
                         |||:.| ||   |.|:  .|.:.|:   .|...|.:.|.:.:     |...|
 Frog   955 -------------SQSQLSFNS---YPSK--GKPADLE---PLDRPINEKRYDPV-----PQVTS 993

  Fly  2028 KRGMGRPAPIYETREESILQSRENETDEKKEKECKTEQIQVEINAQPEEQIEDSTLSRSDLQKSS 2092
            .....:|:|:.           .|.:...|....:...:.||        :..||:|:.:...:.
 Frog   994 SNQYTQPSPVV-----------VNHSTHAKHMHLEASSVSVE--------VPSSTVSKPEPPPTQ 1039

  Fly  2093 DTVIENPARAPLVQDEVDDDEEEEVQD----QRD-PAESSADQTEQPTAIENNLHNEGMVEQSQN 2152
                   |:..|.:   ..:.|:.||.    |:. |.:|..:.|||........:|....:...|
 Frog  1040 -------AKPTLFR---PSNREDTVQSNFYPQKSFPEKSPVNGTEQAPKTVTPSYNRFTPKPYTN 1094

  Fly  2153 DS---DDVFEAADKVSPLAPPPAPVQPPTPRSGRAPFHISNILKRTAPPPS-SPIGDSCTSIETQ 2213
            .:   :..||:......|.|..|.|:|..|               |.|..| .|:..|.|||.::
 Frog  1095 SARPFERKFESPKFNHNLLPNEAQVKPELP---------------TKPQNSPQPVLKSNTSISSE 1144

  Fly  2214 YTS-----QASLPVGPPNATSTPFSSSMSLPIAGPVNNQPSANGRFPTLPREPSTSRGFFDSNGG 2273
            ..|     :......|.|....|.:..:| |.|...:::..|:       ...:|:||||:||||
 Frog  1145 LDSISKQTENKSKYQPNNVNPVPKAIPVS-PSALEDDDEDDAH-------TVVATARGFFNSNGG 1201

  Fly  2274 TLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPPLDMENGETMLSPLVMCGPQGLE 2338
            .|:.....||:.||.||||.|:.|||||.|.  |....:  ||||.|.|||:|||||||||.||:
 Frog  1202 VLSSIETGVSIIIPQGAIPDGIEQEIYFKVC--RDNSIL--PPLDKEKGETLLSPLVMCGPHGLK 1262

  Fly  2339 FLVPVTLNIPHCAGRTA-SLGLALKATDSEKNLHTEWDNIDLPSN----AAAHTVSVKVDHF 2395
            |:.||.|.:||||..|. ....|||::|:.......|.|..||.:    ..|:.|||.:|||
 Frog  1263 FVKPVELRLPHCASMTPDGWSFALKSSDTSSGDPKHWQNKSLPGDPNYLVGANCVSVLIDHF 1324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 37/78 (47%)
SH3_ZO 729..790 CDD:212793 32/61 (52%)
GuKc 831..1007 CDD:214504 81/177 (46%)
ZU5 2263..2351 CDD:279170 52/88 (59%)
tjp1XP_017947903.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115523239
eggNOG 1 0.900 E1_KOG3580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.