DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pyd and tjp3

Sequence 1:NP_001246998.1 Gene:pyd FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_004911110.1 Gene:tjp3 XenbaseID:XB-GENE-995512 Length:1038 Species:Xenopus tropicalis

Alignment Length:1077 Identity:299/1078 (28%)
Similarity:481/1078 (45%) Gaps:242/1078 (22%)


  Fly   237 RFKKGD---RTTWEYHTVAVTRVPGYGFGIAVSGGRDNPHFANGDPSIAVSDVLKGGPAEDRLQV 298
            ||:..|   .|.||.:||.:.|.|..|||||:|||||.|...:||.|:.||||::||||:.|||.
 Frog     4 RFQVSDMEEMTIWEQYTVTLIRDPRRGFGIAISGGRDRPLGTDGDNSVIVSDVIRGGPADGRLQT 68

  Fly   299 NDRIISVNGVSLENVEYATAVQVLRDSGNTVQLVVKR----RVPLN------------------- 340
            .|||:.|||||:|||..:.|:|.|:....|..:.|||    ::|::                   
 Frog    69 RDRIVMVNGVSMENVSSSFAIQTLKSCAKTANVTVKRPRKIQIPVSNSMHPASTYSSHTQKSSDP 133

  Fly   341 -------------------------------PINAAGAVQHQHSHSLSSVGLMAN---------- 364
                                           |.:.|...:...|...||.|..::          
 Frog   134 VFSDTSRREKDDGSDSPLPWRGRYESSNQEPPEDTARGYEGDSSSGRSSQGSFSHSSRHTRHRRG 198

  Fly   365 ---GSGGV---------------------------APTPITSLSQPNSLNSSLVQNAS------- 392
               ||.||                           ....|.|.|:.....|...:..|       
 Frog   199 RTVGSEGVDYAKRKVGRETVSSGSETGRRSRRRESGSDVIDSSSEARGYYSKRKETGSEMGGSGS 263

  Fly   393 -------------SG-----------QPIKVTLTKGGKKDDYGVVLGCRLFVKEISSKAREQLNA 433
                         ||           :|||..|.|..:..:||:.||.::|:|.|:...   |.|
 Frog   264 EIGERYQNGLELVSGFKRLPIQDVPAKPIKAVLVKRAENQEYGLKLGSQIFIKHITESG---LAA 325

  Fly   434 NGYSLQEGDIITRIHNTNCGDTMSLKEAKKIIDGCKERLNLVVLRDITNQTAVSQLNLNNSASHQ 498
            ...:|||||:|.:|:... .:.|||.:.:::|:..:.:|.|.||||                :.|
 Frog   326 QEKALQEGDLILKINGVT-SENMSLADTRRLIEKSRGKLTLTVLRD----------------NRQ 373

  Fly   499 ASGNIYATHQPQVSGCSSSNNNLEDPYLPGGASYSSQNLYVQPP-------TRTSNGPNINGNGL 556
            ...||......:..|.||...::.:   .|...:...:....||       |..|:|......|:
 Frog   374 FLVNIPEVRDSESEGRSSPREDISE---IGSEDFPPPSEAPPPPPAHQQISTSESDGSASEEQGM 435

  Fly   557 NDEKSNLTPRGRSRGPIMDGVSLQQLDRPVTPTRGRSAAI-----DEPPRPPPPRGSSGGAAQED 616
            |..               :.|...:..:.....:...|.:     :|...|       ....:||
 Frog   436 NGS---------------EAVQKMENSKVEIAVKNEEAQVVSTYREESVNP-------NNNTRED 478

  Fly   617 FYSSRRQLYEERQSAEPRFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKV 681
            ..:.        .|.:.|.|.|.||.|:|:||.|||:.||||.|||..|||..:|:..||:||:|
 Frog   479 LRTG--------YSPDARVIQFMKEKSIGLRLAGGNDVGIFVAAVQAASPAEREGMKEGDQILQV 535

  Fly   682 NDMDMNGVTREEAVLFLLSLQDRIDLI--VQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGEM 744
            ||...:.:|||:||.:|:.|....|:|  .|..::.|.:::.:..||||:|:|||..::.:...:
 Frog   536 NDTSFHNLTREDAVQYLMGLPQNEDVIFLTQGKEDIYRKMIKSNVGDSFYIRTHFDYESDAPSGL 600

  Fly   745 AFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNANES 809
            :|..|::|.::||::.|.:|||..:::.|..:|.::|:|||.:|||:.|:.:  ...|..:::..
 Frog   601 SFTRGEIFHIVDTMYRGKIGSWLAVRVARDLKEKEKGIIPNNNRAEQYASLE--PVLKPQSSSGQ 663

  Fly   810 RGNFFRRRRSTHRRSKSLSRENWDDVVFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARER 874
            |..|::.|..  |.:|.|.|::.:|:.......|:|.|||||||...|.||||:.||::|:|.::
 Frog   664 RAEFWKLRGL--RGAKKLLRKSREDLAALSKKIKYPPYERVVLREASFKRPVVVMGPITDIAHQK 726

  Fly   875 LAKDFPDKFSTPLQDDDKSAATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVV 939
            |..|.|.:|.:.   :..:....|..::::|..:|::..:.|||||:|||.||:.|||.||||:|
 Frog   727 LCADLPQEFESA---ESVTRDGGGTSKVIKLDVVREIAAKNKHALLEITPTAVEHLNYMQFYPIV 788

  Fly   940 IFLKTDSKHVIKQLRHGLPKAAHKSSKKLLEQCQKLERVWSHIFSTQIALSD-EESWYRKLRDSI 1003
            :|...:::..:|.:|..|...:.|||::|..|..|..:...|:|:..|.||. .:||.|.|::.|
 Frog   789 VFCNPENRQGVKAMRKWLLPDSRKSSRRLYAQAVKQRKNNFHLFTATINLSGASDSWLRSLKEII 853

  Fly  1004 DLQQSGAVWMSESK------PVESLSD------DFLFPMTTSRLSYASSPESDLELSPGPSASLS 1056
            ..:|:..:|.:|.|      |::.|.|      |:        ||..|...||.|.:.....:.:
 Frog   854 QTEQTKPIWTTEDKENTITEPLDLLDDSTAEVNDY--------LSCDSRANSDYEETDAEGGAYT 910

  Fly  1057 LGNLPQLVKASSDPSIA-TNQDNLDRDRDIIGEGLPPPYTVPY-DHAVPANPNRRQTMD----SS 1115
            ...|.:.::   :|::| :::..||..........|..|...| |.::|...|...|..    ||
 Frog   911 DQELEEEIQ---EPALARSSEPVLDYQSTYYRAHSPDDYPSEYKDQSLPETNNIHGTKPRPELSS 972

  Fly  1116 KY--SIYGTNVPPQQQQPGVGGDTAAVRPQSLYGINA 1150
            .|  |:...:..|||:        :..:||..:..:|
 Frog   973 NYRSSLPSNDDSPQQE--------SVSQPQGQWSASA 1001

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492 45/85 (53%)
PDZ_signaling 396..477 CDD:238492 28/81 (35%)
PDZ_signaling 633..710 CDD:238492 39/79 (49%)
SH3_ZO 729..790 CDD:212793 21/61 (34%)
GuKc 831..1007 CDD:214504 64/177 (36%)
ZU5 2263..2351 CDD:279170
tjp3XP_004911110.1 PDZ_signaling 19..104 CDD:238492 45/85 (53%)
PDZ_signaling 292..368 CDD:238492 27/80 (34%)
PDZ_signaling 489..552 CDD:238492 34/63 (54%)
SH3_ZO-3 582..646 CDD:212961 24/64 (38%)
NK 681..857 CDD:302627 65/179 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115544527
eggNOG 1 0.900 E1_KOG3580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1175136at2759
OrthoFinder 1 1.000 FOG0001893
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.