DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: M1BP and si:ch211-216l23.1

Sequence 1:NP_649825.1 Gene:M1BP FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005159186.1 Gene:si:ch211-216l23.1 ZFINID:ZDB-GENE-060503-121 Length:1372 Species:Danio rerio

Alignment Length:311 Identity:76/312 (24%)
Similarity:114/312 (37%) Gaps:83/312 (27%)


  Fly   134 EEIDDTKVEYDNTYYEVAEGHAGEDDAASLIEEADYD----SIMAEDEEQQQTLELDEDTELIVG 194
            ||.:.|         |.|.|........:.:.|.|.|    ..:.||.||..|   ..|..:...
Zfish    16 EEAEST---------ECASGWDSSVQTDAAVSERDSDRKESRAVGEDGEQSVT---SHDERVGEE 68

  Fly   195 DVNDAYVYDSDDEVAVLDN------VLDDEYEHENIVVKKC-------------SLPPKPKVRSD 240
            |::       ||.:...||      .|.|..||.   ...|             :..|..|..:.
Zfish    69 DLD-------DDSIFTCDNCQQDFECLADLTEHR---TNHCPADGDDDPGLSWVASSPSSKDVAS 123

  Fly   241 DARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFG------CELCQSRFCTTSELKRHMR 299
            .::..|.|    |...|              ...|:::.|      |:.|...|...|.||||.:
Zfish   124 PSQMLGDG----CCDMG--------------MGTGEEEGGSGLPYPCQFCDKSFSRLSYLKRHEQ 170

  Fly   300 KHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYR 364
            .|:.:.||.|.:|.|.|....:|.:|.:.||.::.|.|..|..||:....||.|:..||..:.::
Zfish   171 IHSDKLPFKCTFCSRLFKHKRSRDRHVKLHTGDKKYSCQECEAAFSRSDHLKIHLKTHSSSKPFK 235

  Fly   365 CELCDKSF----MLPTHLSTHFRSGVHKRHLEKAEM-------KQVLEQEQ 404
            |.:|.:.|    .|.:|:..|.:   :|.||.|.:.       ..|.||:|
Zfish   236 CSICKRGFSSTSSLQSHMQAHRK---NKEHLAKKDQGKRDGSSSDVTEQDQ 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 2/20 (10%)
COG5048 276..>331 CDD:227381 20/61 (33%)
C2H2 Zn finger 281..301 CDD:275368 8/20 (40%)
zf-H2C2_2 293..317 CDD:290200 11/24 (46%)
C2H2 Zn finger 309..329 CDD:275368 6/20 (30%)
zf-H2C2_2 324..346 CDD:290200 8/22 (36%)
C2H2 Zn finger 337..357 CDD:275368 7/20 (35%)
zf-H2C2_2 350..372 CDD:290200 7/22 (32%)
C2H2 Zn finger 365..383 CDD:275368 6/22 (27%)
si:ch211-216l23.1XP_005159186.1 COG5048 <151..256 CDD:227381 34/105 (32%)
C2H2 Zn finger 152..172 CDD:275368 8/20 (40%)
C2H2 Zn finger 180..200 CDD:275368 6/20 (30%)
COG5048 206..>539 CDD:227381 24/82 (29%)
C2H2 Zn finger 208..228 CDD:275368 7/20 (35%)
C2H2 Zn finger 236..256 CDD:275368 5/20 (25%)
C2H2 Zn finger 288..307 CDD:275368
C2H2 Zn finger 439..460 CDD:275368
C2H2 Zn finger 471..492 CDD:275368
C2H2 Zn finger 515..534 CDD:275368
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 707..728 CDD:275368
C2H2 Zn finger 738..755 CDD:275368
C2H2 Zn finger 766..783 CDD:275368
C2H2 Zn finger 796..817 CDD:275368
C2H2 Zn finger 833..853 CDD:275368
C2H2 Zn finger 859..877 CDD:275368
C2H2 Zn finger 956..977 CDD:275368
C2H2 Zn finger 1002..1022 CDD:275368
C2H2 Zn finger 1031..1051 CDD:275368
C2H2 Zn finger 1288..1308 CDD:275368
C2H2 Zn finger 1319..1340 CDD:275368
C2H2 Zn finger 1349..1365 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.