DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: M1BP and znf408

Sequence 1:NP_649825.1 Gene:M1BP FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001315204.1 Gene:znf408 ZFINID:ZDB-GENE-130530-589 Length:764 Species:Danio rerio

Alignment Length:517 Identity:113/518 (22%)
Similarity:168/518 (32%) Gaps:173/518 (33%)


  Fly    54 LPDQIC---ECCSMELA-----SAVKLRER-----C--IAAQRELLL------GLTEEQRQGISA 97
            :.|::|   ..||.:.|     |.:|:..|     |  |....||||      .:|||:...   
Zfish    85 ISDEVCWMQFACSAQSAEESNVSVLKVDGRLGLKVCRDIQPGTELLLWESHPEAVTEEETPQ--- 146

  Fly    98 FYRAAVMGEDIVQTVKTPDDDEVYAT------------YQEIVLEEPKEEIDDTKVEYDNTY--- 147
                       |:|.:..:.||....            .|.:..::.|..:....:..|||.   
Zfish   147 -----------VETCENREQDEALEANTSDHFSGSPYLLQRVTQQDTKSPVTVKGLVQDNTICNS 200

  Fly   148 -------YEVAEG-HAGEDDAASLIEEADYDSIMAEDEEQQQTLE--------LDEDTELIVGDV 196
                   .|.:|. |:.|..|...||..:..:..|:...|..|.|        |......:....
Zfish   201 NVLEQNGMEESEAEHSDELPATEEIESINVSASQAQTSSQCLTPERSLRTSSRLASKPRKVHSSA 265

  Fly   197 NDAY-----------------VYDSDDEVAVLD-----------------NVLDDEY---EHENI 224
            ...|                 :...||.:..|.                 |:.:.:|   |.:..
Zfish   266 KRIYKRHDPKNKPDLSSKKKLLNSKDDLMQPLTVKEESSTKQNGQDFPPFNIRERKYKCEECDKS 330

  Fly   225 VVKKCSLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFC 289
            ..:.|.| .|.|....:.:      .|.|.:||.......:|:.|...|||.:.|.||.|...:.
Zfish   331 FFQLCHL-KKHKYTHQNQK------PYTCTECGKSYSSHESFQAHLLMHRGQRPFKCEQCDKSYG 388

  Fly   290 TTSELKRHMRKHTGERPFACKYCGRCFT-----------------DY-TTRVK------------ 324
            ...:||.|...|:||:||.|..||:.|.                 || ..:||            
Zfish   389 LKRDLKEHQVLHSGEKPFVCDICGKAFARRPSLRVHREIHRTKEPDYQALKVKCPECDKELANSG 453

  Fly   325 ----HERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFM----LPTHLSTH 381
                |.|.||.|||::|..|.|.|.....|:.||.||:||:.|||:.||..|.    |..||.:|
Zfish   454 SLRNHMRLHTGERPHICPHCNKCFRQRGNLQGHMRIHTGEKPYRCDHCDLRFSQVPELRRHLISH 518

  Fly   382 -------------------------FRSGVHKRHLEKAEMKQVLEQEQKRELKEEEEDSLHI 418
                                     ..:|......|:......:..:.:|.||...|:..|:
Zfish   519 TGEVYLCPVCGKALRDPHTLRAHERLHTGDRPYKCEQCGKGYTMATKLRRHLKSHLEEKQHV 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 12/45 (27%)
C2H2 Zn finger 253..273 CDD:275368 5/20 (25%)
COG5048 276..>331 CDD:227381 24/89 (27%)
C2H2 Zn finger 281..301 CDD:275368 6/20 (30%)
zf-H2C2_2 293..317 CDD:290200 12/24 (50%)
C2H2 Zn finger 309..329 CDD:275368 10/54 (19%)
zf-H2C2_2 324..346 CDD:290200 12/38 (32%)
C2H2 Zn finger 337..357 CDD:275368 8/20 (40%)
zf-H2C2_2 350..372 CDD:290200 12/22 (55%)
C2H2 Zn finger 365..383 CDD:275368 8/47 (17%)
znf408NP_001315204.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.