DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11755 and Cdpf1

Sequence 1:NP_001262381.1 Gene:CG11755 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001158097.1 Gene:Cdpf1 MGIID:1919605 Length:119 Species:Mus musculus

Alignment Length:108 Identity:38/109 (35%)
Similarity:60/109 (55%) Gaps:7/109 (6%)


  Fly    43 FNCSGCEMHEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGTKCSICSKT 107
            |.|..|.:.....|.|:|||....|:..|::|:|:|||.....|       ::.:|::||:||:.
Mouse    13 FECQLCALSAPYSYVGQKPPDTQAVVLLEESYIMKDPFSSDKAR-------FLVLGSRCSVCSRL 70

  Fly   108 VCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQMSVSQ 150
            ||..|.||.:|:...||||.:|.:..:|.|.|..:.|:.|.|:
Mouse    71 VCVGPDCSLFYSKRVCLPCVQENMSAFPQEIQQDVEKRKSTSK 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 35/100 (35%)
Cdpf1NP_001158097.1 C6_DPF 13..106 CDD:287179 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170789917
eggNOG 1 0.900 E1_KOG4543
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5086
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006023
OrthoInspector 1 1.000 T1084245
orthoMCL 1 0.900 OOG5_137114
Panther 1 1.100 LDO PTHR31849
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3746
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.