DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11755 and D2089.8

Sequence 1:NP_001262381.1 Gene:CG11755 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001338812.1 Gene:D2089.8 WormBaseID:WBGene00271706 Length:137 Species:Caenorhabditis elegans

Alignment Length:120 Identity:43/121 (36%)
Similarity:58/121 (48%) Gaps:19/121 (16%)


  Fly    23 EELKKPIDPEEEDERVARIEFNCSGCEMHEMVHYFGRKPPFALGVI---YPEDNYVMRDPFQPPP 84
            ||..:.|||        .|:|.|..|.:.|.. .||.     |.||   |....|.|||||:||.
 Worm    19 EEQPQLIDP--------FIDFECHVCHLKERT-LFGE-----LKVIDGRYDSPVYFMRDPFKPPS 69

  Fly    85 PRWQSKP--EYYIAMGTKCSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPE 137
            .....||  ..::.:||.||.|::.||....||.::.|:||.||...|.:.:||:
 Worm    70 RDRAKKPCLNDFLVLGTPCSACNQPVCMSDACSLFFGANFCAPCVSRERRRFPPQ 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 37/101 (37%)
D2089.8NP_001338812.1 C6_DPF 31..125 CDD:313408 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170787280
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1594478at2759
OrthoFinder 1 1.000 FOG0006023
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31849
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.