DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11755 and cdpf1

Sequence 1:NP_001262381.1 Gene:CG11755 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002942333.1 Gene:cdpf1 XenbaseID:XB-GENE-5904319 Length:164 Species:Xenopus tropicalis

Alignment Length:111 Identity:37/112 (33%)
Similarity:61/112 (54%) Gaps:7/112 (6%)


  Fly    35 DERVARIEFNCSGCEMHEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGT 99
            ||...:..|.|..|.:.....|:|::||.:..|:..|:.:|.:|||.|       :.|.::.:|:
 Frog    55 DEPQPKGLFECELCRLSVPYTYYGQRPPNSQSVVLLEECFVTKDPFTP-------EKEKFLILGS 112

  Fly   100 KCSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQ 145
            .||:|.|:||....||.:|:..|||||..:..:.:|||.|..:.|:
 Frog   113 PCSLCKKSVCVGTECSLFYSKRFCLPCVTQHREGFPPEIQQDLDKR 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 34/100 (34%)
cdpf1XP_002942333.1 C6_DPF 63..156 CDD:287179 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1594478at2759
OrthoFinder 1 1.000 FOG0006023
OrthoInspector 1 1.000 T1060224
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.