DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11755 and cdpf1

DIOPT Version :9

Sequence 1:NP_001262381.1 Gene:CG11755 / 41031 FlyBaseID:FBgn0037611 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_002942333.1 Gene:cdpf1 / 100494076 XenbaseID:XB-GENE-5904319 Length:164 Species:Xenopus tropicalis


Alignment Length:111 Identity:37/111 - (33%)
Similarity:61/111 - (54%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DERVARIEFNCSGCEMHEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGT 99
            ||...:..|.|..|.:.....|:|::||.:..|:..|:.:|.:|||.|       :.|.::.:|:
 Frog    55 DEPQPKGLFECELCRLSVPYTYYGQRPPNSQSVVLLEECFVTKDPFTP-------EKEKFLILGS 112

  Fly   100 KCSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQ 145
            .||:|.|:||....||.:|:..|||||..:..:.:|||.|..:.|:
 Frog   113 PCSLCKKSVCVGTECSLFYSKRFCLPCVTQHREGFPPEIQQDLDKR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11755NP_001262381.1 C6_DPF 43..143 CDD:287179 34/99 (34%)
cdpf1XP_002942333.1 C6_DPF 63..156 CDD:287179 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5044
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1594478at2759
OrthoFinder 1 1.000 - - FOG0008913
OrthoInspector 1 1.000 - - oto102986
Panther 1 1.100 - - LDO PTHR31849
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6656
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.