DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: p and tecpr2

Sequence 1:NP_001303455.1 Gene:p FlyBaseID:FBgn0086679 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_002936632.2 Gene:tecpr2 XenbaseID:XB-GENE-5827246 Length:1396 Species:Xenopus tropicalis

Alignment Length:639 Identity:129/640 (20%)
Similarity:230/640 (36%) Gaps:210/640 (33%)


  Fly    13 FSLSLSLPLKHHNRIK-----YTCFDISDSYIIFGASSGSLYLFNRN----GKFLLLIPNKHGAI 68
            :|:..::|.|.....:     .|..|.:..:|..|:|.|.|||:.|:    .|:.|     .|..
 Frog    16 YSILNAIPAKVQKGFRSILVYLTALDANSDFIAVGSSIGMLYLYCRHTSQMKKYSL-----EGKT 75

  Fly    69 TSLSI----SANSKYVAFATQRSLICVYAVNLSAQATP-----------QVIFTHLDQSVQVTCI 118
            .|:|:    |.....||..|....:.|:.:     .:|           .|:..|   ...:|.:
 Frog    76 ESISVVKLLSCFDDLVAVGTVSGRVAVFQL-----VSPLPGRNKQLRRFDVLGIH---KSNITAL 132

  Fly   119 HWTQDEKQFYYGDSRGQVSLVLLSSFIGHSLLFNMTV-HPLLYLD--SPIVQIDDFEYLLLVSNC 180
            .|:.:..:.:.||.||::        |...|.|:..: :|.|.|:  |.:||:|..:.:||||..
 Frog   133 AWSPNGMKLFSGDDRGKI--------IQSDLDFDKGLCNPSLILEELSSVVQLDYSQKVLLVSTT 189

  Fly   181 TKCILCNTEYEDYKQIGNRPR--DGAFGACFF--VSPQESLQPSRIYCARPGSRVWEVDFEGEVI 241
            .:|:|..||.:..||:|.:||  :|.:||||.  :..|..|   :::.:|||.|:|:.|..|.|.
 Frog   190 QRCLLFYTEEKAVKQVGTQPRKSNGKYGACFIPGLCKQSDL---KLFASRPGLRLWKSDVHGCVQ 251

  Fly   242 QTHQFKTALATAPARIQRPGSGTDELDANAELLDYQPQNLQFAKVQRLNDD-------------- 292
            .|...|...           .|.::.:.             :.:|:..|.|              
 Frog   252 STFILKDMF-----------KGLEQFEL-------------YPRVETSNKDSFVLSEKHFGLLYC 292

  Fly   293 -----FLLAFTELGLYIFDIRRSAVVLWSNQFERIADCRSSGSEIFVF-----------TQSGAL 341
                 ::|::.|..:|:.|....||:........|.....:.:|||..           ...|||
 Frog   293 FLHEGWVLSWDEYSIYLIDTVNQAVIGGLESSGDIVSVSCTNNEIFFIKGDREIIRISNMPEGAL 357

  Fly   342 YSVQLQTLQSHAVSLIQQSKLLPCANLLRQHVRYFADKAREDYELKQLNPLKQLLIERQEYEL-- 404
            ::......::|.....:..|         .|:...:       |:|:.|.:....|:.::.:|  
 Frog   358 FASLHSPFRAHTPVFTEDGK---------HHIGALS-------EMKENNKIDVQSIKTEKIQLCA 406

  Fly   405 LNDISVIFD-----AITQCTGSALDTHSSGGSSATTERSLSGGSSSRAPPKGVYVLENAFCDNLK 464
            :.|...:.|     .|..|:..|.:..|...|:    .|:..|.|                    
 Frog   407 IEDEESLLDQGTDMRIRTCSLPADEVKSRSSST----NSIDSGFS-------------------- 447

  Fly   465 QPLKTGHFKDALLTVTGK-----FGKNIIKYKFNIFAEE--QQQLVRELIPASERSLPFKDIKAR 522
                        ||||.:     .|:.....:|:|.:.|  .|:||.:.:...::.      |.|
 Frog   448 ------------LTVTAEPGSPNNGQRPTSQRFSIISNEDFDQELVVKSMKVKKKK------KKR 494

  Fly   523 Y-ESGSEDQEEEIVRRCKK-----------------------PAPQVPHISPEE 552
            | |:|.::|:     .|.:                       |...:.|:|.:|
 Frog   495 YVENGLKNQD-----ACSRESTPSTDSPLTLNSDFFSATEICPVSSIDHLSSQE 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pNP_001303455.1 WD40 <17..>132 CDD:225201 29/139 (21%)
WD40 <21..128 CDD:295369 26/131 (20%)
WD40 repeat 25..63 CDD:293791 12/47 (26%)
WD40 repeat 68..107 CDD:293791 9/54 (17%)
WD40 repeat 116..154 CDD:293791 9/38 (24%)
WD40 repeat 161..196 CDD:293791 15/37 (41%)
WD40 repeat 204..245 CDD:293791 15/43 (35%)
tecpr2XP_002936632.2 WD40 34..419 CDD:225201 96/449 (21%)
WD40 repeat 39..73 CDD:293791 11/39 (28%)
WD40 <68..>159 CDD:295369 22/112 (20%)
WD40 repeat 78..123 CDD:293791 8/50 (16%)
WD40 repeat 130..167 CDD:293791 11/45 (24%)
WD40 repeat 174..207 CDD:293791 14/33 (42%)
Hyd_WA 934..960 CDD:283993
Hyd_WA 983..1013 CDD:283993
Hyd_WA 1168..1195 CDD:283993
Hyd_WA 1268..1296 CDD:283993
Hyd_WA 1311..1339 CDD:283993
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.