DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mkk4 and STK26

DIOPT Version :10

Sequence 1:NP_477353.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_057626.2 Gene:STK26 / 51765 HGNCID:18174 Length:416 Species:Homo sapiens


Alignment Length:67 Identity:14/67 - (20%)
Similarity:31/67 - (46%) Gaps:10/67 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LVEWLMRVQGERLDEQRSE----------LPPIKPEGQEEVDKKKEEDVTAIVMRMQAGRLEDQR 90
            |:|:|::...||:.:|..|          ...:..:|:::....:|:....:.:.....||.::|
Human     3 LMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREER 67

  Fly    91 AH 92
            ||
Human    68 AH 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mkk4NP_477353.1 PKc_MKK4 115..405 CDD:270790
STK26NP_057626.2 STKc_MST4 19..295 CDD:132971 8/51 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..340
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.