DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and Gm14322

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001230832.1 Gene:Gm14322 MGIID:3652185 Length:358 Species:Mus musculus

Alignment Length:258 Identity:84/259 (32%)
Similarity:132/259 (51%) Gaps:31/259 (12%)


  Fly   124 GVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHK 188
            |....:|..||..|:...|.:.| :..|......||.:..:.|.::...:||..::  |.::.::
Mouse    99 GGKHHDCNQCGKDFRTRNVPQIH-KRTHTGEKPYDCNQYGKAFARISHLRVHKRTH--TGEKPYE 160

  Fly   189 CLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFV 253
            |.:|||...|:|.|..|.|.||.|.|:.|:||.|||..:..|.:|:|.|....:::|..||:.|.
Mouse   161 CNQCGKAFASSSDLQKHKRTHTGEKPYECNQCGKAFAQSSHLRIHKRTHAGDKRYECNQCGKAFT 225

  Fly   254 ESSNL----------RRHIVNR-----------------HTEERPHLCNVYQRSFSRVYMLELHL 291
            :|:||          :|:..|:                 ||.|:|:.||...::|::...|:.|.
Mouse   226 QSNNLQIHKGTHAGEKRYECNQCGKAFASSSDLQKHKRTHTGEKPYECNQCGKAFAKSCDLQKHK 290

  Fly   292 RTNTGERPYACQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHETGQ 354
            ||:|||:||.|:...|.||....|:||.|.||||:.:.|:.|.|.|.::..||.|...| ||:
Mouse   291 RTHTGEKPYECKQCGKAFAVSYTLQIHNRTHTGEKPYECKQCGKAFAQSSNLRIHKQTH-TGE 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368 4/20 (20%)
COG5048 184..>250 CDD:227381 26/66 (39%)
C2H2 Zn finger 189..209 CDD:275368 9/20 (45%)
C2H2 Zn finger 217..237 CDD:275368 9/20 (45%)
C2H2 Zn finger 245..262 CDD:275368 8/27 (30%)
C2H2 Zn finger 274..294 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 8/20 (40%)
zf-H2C2_2 315..339 CDD:290200 12/24 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
Gm14322NP_001230832.1 KRAB 4..>45 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 77..96 CDD:275368
C2H2 Zn finger 105..125 CDD:275368 6/21 (29%)
C2H2 Zn finger 133..153 CDD:275368 4/20 (20%)
COG5048 <138..347 CDD:227381 71/211 (34%)
zf-H2C2_2 145..170 CDD:290200 7/27 (26%)
C2H2 Zn finger 161..181 CDD:275368 9/20 (45%)
zf-H2C2_2 173..198 CDD:290200 13/25 (52%)
C2H2 Zn finger 189..209 CDD:275368 9/20 (45%)
zf-H2C2_2 201..226 CDD:290200 8/25 (32%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..265 CDD:275368 1/20 (5%)
zf-H2C2_2 257..281 CDD:290200 7/24 (29%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 285..309 CDD:290200 12/24 (50%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 314..338 CDD:290200 12/24 (50%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.