DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG31365

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:312 Identity:80/313 (26%)
Similarity:121/313 (39%) Gaps:66/313 (21%)


  Fly    24 YEIVEEMQVDLCTLLETCGGIKVDR-RDVQPMYLCQECTNELLIAAKFRKICVESEKLRDMAPEI 87
            |.|.|:.::..       .|.|.:. .||....|.:|.:.|..:.:....:.:..::..|.    
  Fly   359 YNIKEDGEIQF-------SGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDR---- 412

  Fly    88 NIDTAEPL---ASEEIIIIDPSDYIEQLSAVEDPENEPI--GVSRWNCQHCGAGFQLSEVLRRHI 147
              |...||   .|.|::       .:|.|:...|:...|  .|..:.|..|...|...::|.|| 
  Fly   413 --DEQTPLKRKRSSELV-------FKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRH- 467

  Fly   148 QEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGH----KCLECGKCLQSASSLASHIRL 208
                                       || ::.|..|.|.    ||..|...|..||||..|:.:
  Fly   468 ---------------------------HN-THIKGLKSGKGGTLKCPSCALQLSCASSLKRHMII 504

  Fly   209 HTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHT-EERPH 272
            ||...||.|.:|..:|.....|:.|...|..|.:|:|..|...|.:.|||::||...|. ..|.|
  Fly   505 HTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTH 569

  Fly   273 LCNVYQRSFSRVYMLELHLRTNTGERPYAC-----QHRDKRFAQLGVLKIHE 319
            .|::..|||:.|..|..||.|:.|.. ::|     |..|:...|..|..:|:
  Fly   570 KCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMHK 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 10/57 (18%)
C2H2 Zn finger 159..179 CDD:275368 2/20 (10%)
COG5048 184..>250 CDD:227381 25/70 (36%)
C2H2 Zn finger 189..209 CDD:275368 8/20 (40%)
C2H2 Zn finger 217..237 CDD:275368 5/20 (25%)
C2H2 Zn finger 245..262 CDD:275368 7/17 (41%)
C2H2 Zn finger 274..294 CDD:275368 9/20 (45%)
C2H2 Zn finger 302..322 CDD:275368 6/24 (25%)
zf-H2C2_2 315..339 CDD:290200 1/6 (17%)
C2H2 Zn finger 330..350 CDD:275368
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 28/105 (27%)
C2H2 Zn finger 485..505 CDD:275368 8/20 (40%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 5/20 (25%)
zf-H2C2_2 526..550 CDD:290200 8/24 (33%)
C2H2 Zn finger 541..562 CDD:275368 8/21 (38%)
C2H2 Zn finger 571..591 CDD:275368 9/20 (45%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.