DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG4854

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650860.1 Gene:CG4854 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster

Alignment Length:337 Identity:85/338 (25%)
Similarity:140/338 (41%) Gaps:50/338 (15%)


  Fly     5 SGEFRCRVCLKQ--DELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIA 67
            |.:.:||:||.|  ||.|:       ..:.|....::.|.|:::......|..:|..|...|..|
  Fly     7 SRDLKCRICLVQPKDESLM-------PTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAA 64

  Fly    68 AKFRKICVESEK-LRDM-APEINIDTAEPLASEEIIIIDPSDYIEQLSAVEDPENEPIGVSRWNC 130
            .|.|.:|.::|| |::. ..||||:          |:.|..:..::..:.:..:||..|..    
  Fly    65 LKLRSLCQQTEKDLKEQKLQEINIE----------IVHDEQETKKKTESRDLSKNEATGSD---- 115

  Fly   131 QHCGAGFQLSEVLRRHIQEVHASITI---IDCRERRRIFTKLGCYQVHNCSYAKTPK-------- 184
                     ||:...::.....::..   :.|.....:..:..........|:.:||        
  Fly   116 ---------SELEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTFEDED 171

  Fly   185 ----RGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKC 245
                ....|..|.........|.:|:::|:.:.|..|:.|.|.||....|..|...|.....:||
  Fly   172 SGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKC 236

  Fly   246 LHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFA 310
            .:|...|.:.|...:| ...||.|||:.|....|||....:|.:||:|:|||||::||:..|.|:
  Fly   237 DYCDSRFADPSTRIKH-QRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFS 300

  Fly   311 QLGVLKIHERIH 322
            ||.....||:.|
  Fly   301 QLHHKNSHEKSH 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 21/73 (29%)
C2H2 Zn finger 159..179 CDD:275368 1/20 (5%)
COG5048 184..>250 CDD:227381 18/78 (23%)
C2H2 Zn finger 189..209 CDD:275368 4/20 (20%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..262 CDD:275368 5/17 (29%)
C2H2 Zn finger 274..294 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 8/20 (40%)
zf-H2C2_2 315..339 CDD:290200 3/9 (33%)
C2H2 Zn finger 330..350 CDD:275368
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 13/52 (25%)
C2H2 Zn finger 180..200 CDD:275368 4/20 (20%)
zf-H2C2_2 193..217 CDD:290200 9/24 (38%)
COG5048 201..>258 CDD:227381 17/58 (29%)
C2H2 Zn finger 208..228 CDD:275368 7/20 (35%)
zf-H2C2_2 221..244 CDD:290200 7/23 (30%)
C2H2 Zn finger 236..256 CDD:275368 5/21 (24%)
zf-H2C2_2 251..273 CDD:290200 10/23 (43%)
C2H2 Zn finger 264..284 CDD:275368 8/20 (40%)
zf-H2C2_2 277..301 CDD:290200 13/24 (54%)
C2H2 Zn finger 292..312 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.