DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG4424

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster

Alignment Length:372 Identity:102/373 (27%)
Similarity:155/373 (42%) Gaps:100/373 (27%)


  Fly    10 CRVCLKQDEL-LVDIYEIVEEM---QVDLCTLLETCGGIKV---DRRDVQPMYLCQECTNELLIA 67
            ||.||:..|. :|.|::..::.   .|.||..:|:..||::   .:.:|.|..:|..|...|.:|
  Fly    11 CRTCLQDGEAHMVSIFQTADDRLPGGVSLCDKIESLSGIQIRATAKEEVLPTRICLRCKAFLTLA 75

  Fly    68 AKFRKIC---------------VESEKLRDMAPEINIDTAEPLASEEIIIIDPSDYIEQLSAVED 117
            .|||:||               ||...::::..:....|..|:.:|::               |.
  Fly    76 HKFRQICQRSNEFLREYVIKDAVEQGVVKEVVQQTRPSTPPPIETEQL---------------EP 125

  Fly   118 PENEPIGVSRWNCQHCGAGFQLSEVLRRHIQEV-HASITIIDCRERRRIFTKLGCYQVHNCSY-- 179
            ||:|.:....|:.:.             .|:|. |....    :||..:.|    .::....|  
  Fly   126 PEDEVLEEGVWSTED-------------PIEETPHGPAE----KERPTVLT----VEMLPAPYPP 169

  Fly   180 -AKTPK-------RG--HKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQ 234
             |.||.       :|  |.|..||......|:|.:|:|.|.||.|:.|:.|.|:|..|       
  Fly   170 PASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDERPYECEICHKSFHVN------- 227

  Fly   235 RRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERP 299
                                 ..|:||| .:||..:|:.|...||:|:....|..|.||:..|||
  Fly   228 ---------------------YQLKRHI-RQHTGAKPYTCQYCQRNFADRTSLVKHERTHRNERP 270

  Fly   300 YACQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKH 346
            |||:...|:|....|||:|.:.||||:.|.||:|.|.|.|...|..|
  Fly   271 YACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARIHNLVAH 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 26/92 (28%)
C2H2 Zn finger 159..179 CDD:275368 3/20 (15%)
COG5048 184..>250 CDD:227381 18/75 (24%)
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 217..237 CDD:275368 5/20 (25%)
C2H2 Zn finger 245..262 CDD:275368 3/17 (18%)
C2H2 Zn finger 274..294 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
zf-H2C2_2 315..339 CDD:290200 13/24 (54%)
C2H2 Zn finger 330..350 CDD:275368 8/18 (44%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 24/81 (30%)
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
DUF45 <204..281 CDD:302795 34/106 (32%)
COG5048 210..>345 CDD:227381 48/138 (35%)
C2H2 Zn finger 217..237 CDD:275368 9/49 (18%)
C2H2 Zn finger 245..265 CDD:275368 8/20 (40%)
zf-H2C2_2 257..282 CDD:290200 12/25 (48%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..310 CDD:290200 13/24 (54%)
C2H2 Zn finger 301..320 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.