DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and CG17802

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster


Alignment Length:445 Identity:104/445 - (23%)
Similarity:161/445 - (36%) Gaps:129/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPPSGEFRCRVC--LKQDELLVDIYEIVEEM--QVDLCTLLETCGGIKVDRRDVQPMYLCQECT 61
            |:|     :||:|  |...:..|:|::...:|  |:.|.|      |:.:......|..:|..|.
  Fly     1 MTP-----QCRLCGDLIYTQNPVNIFDENSKMVRQIALVT------GLWLTDHSKMPRNMCSCCL 54

  Fly    62 NELLIAAKFRKICVESEK---LRDMAPEINID--TAEPL--ASEEIIIIDPSDYIEQLSAVEDPE 119
            ..|..|..||:.|:::..   ::..:.|...|  .|:||  |.|.:.|.|.....|.|..|...:
  Fly    55 LSLKSAIAFRQACIKTNNRLTIQRRSVEAKDDGCWADPLSDAHEGLKINDAEVEQEVLYEVSYAD 119

  Fly   120 NEPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRI-----FTKLGCYQVHNCSY 179
            ||              |.:....|.:..:|   ...:.:.:|...|     |:|....|.....|
  Fly   120 NE--------------GLEEDHDLYKKEEE---ESEVNENKEFEDIACEIPFSKEDDEQEQQQEY 167

  Fly   180 AK--TPKRGH----KCLEC--------------------------------GKCLQSASSLAS-- 204
            ..  ..|.||    :..||                                |.....|.|::.  
  Fly   168 EDMVDKKTGHDDGEESQECEESQPDEEESQQNEEDEEESQEDDDELWQNEDGDSDTDADSMSDIE 232

  Fly   205 ----HIRLHTDEWP---FTCDQCAKAFRTNGALEVHQRRHKQVLQ--HKCLHCGRGFVESSNLRR 260
                ...|..|:.|   :|.....|...|:......::|...:.|  |.|.|||:.|.:..|...
  Fly   233 ATSRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNL 297

  Fly   261 HIVNRHTEERPHLC-NVYQRSFSRVYMLELHLRT-NTGERPYACQHRDKRFAQLGVLKIHER--- 320
            |:: ||:..:|..| ...|:.|:| |:|.:|:|. :.||:|||||..|:||....:...||.   
  Fly   298 HVL-RHSGVKPFECPECGQKEFNR-YILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVH 360

  Fly   321 -----------------------------IHTGERLHRCQVCEKPFTRAGQLRKH 346
                                         :|||||...|:||:..|||...|:.|
  Fly   361 RNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 19/76 (25%)
C2H2 Zn finger 159..179 CDD:275368 5/24 (21%)
COG5048 184..>250 CDD:227381 20/112 (18%)
C2H2 Zn finger 189..209 CDD:275368 5/57 (9%)
C2H2 Zn finger 217..237 CDD:275368 2/19 (11%)
C2H2 Zn finger 245..262 CDD:275368 6/16 (38%)
C2H2 Zn finger 274..294 CDD:275368 8/21 (38%)
C2H2 Zn finger 302..322 CDD:275368 7/51 (14%)
zf-H2C2_2 315..339 CDD:290200 11/55 (20%)
C2H2 Zn finger 330..350 CDD:275368 8/17 (47%)
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 19/75 (25%)
C2H2 Zn finger 282..302 CDD:275368 7/20 (35%)
C2H2 Zn finger 310..331 CDD:275368 8/21 (38%)
C2H2 Zn finger 339..360 CDD:275368 7/20 (35%)
C2H2 Zn finger 371..388 CDD:275370 0/16 (0%)
zf-met 398..421 CDD:289631 8/18 (44%)
C2H2 Zn finger 399..417 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.