DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG6813

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster

Alignment Length:340 Identity:80/341 (23%)
Similarity:133/341 (39%) Gaps:88/341 (26%)


  Fly    10 CRVCLKQDELLVDIY-----EIVEEMQ----VDLCTLLETCGGIKVDRRDVQPMYLCQECTNELL 65
            ||:|.:.| ..:|::     .:|.::.    |:|....|..|            .:|..|.:.|.
  Fly     6 CRICSRSD-APIDLFGPGNGHLVRQIHSITGVELSCKKEISG------------QMCTTCLDNLQ 57

  Fly    66 IAAKFRKICVESEKLRDMAPEINID----TAEPLASEEI------IIIDPSDYIEQLSAVEDPEN 120
            .|.|||:.|:.:||  .....|..|    :.:|:..|:|      ..:|.|....::..:..|..
  Fly    58 AAIKFRQRCIIAEK--QNLERIECDSKDCSTDPIIYEDIDDNQIESELDESILCPEVKDLPMPSA 120

  Fly   121 EPI--------------GVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGC 171
            |.:              |...:.|..||                             ||......
  Fly   121 EKVSAPTSLNHQKSIGGGTGPYVCPDCG-----------------------------RIINNKSN 156

  Fly   172 YQVHNCSYAKTPKRGHKC--LECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQ 234
            :|.|...:  |..:...|  |.|.:...:...|.||.|:||.|.|:.|..|.:.|.::||.:.|.
  Fly   157 FQEHTLRH--TGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHH 219

  Fly   235 RRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERP 299
            |||:...:::|..|.:.||.|..||:|.: .|.:.|.|.|.|.|:.|.|:..|..||.:|..:| 
  Fly   220 RRHRNERRYECDTCKKSFVSSGCLRKHKM-IHVDARNHYCYVCQKHFKRISHLMTHLSSNIHKR- 282

  Fly   300 YACQHRDKRFAQLGV 314
                 ::::..:|.:
  Fly   283 -----KEEKLTELAI 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 20/79 (25%)
C2H2 Zn finger 159..179 CDD:275368 4/20 (20%)
COG5048 184..>250 CDD:227381 22/68 (32%)
C2H2 Zn finger 189..209 CDD:275368 7/22 (32%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
C2H2 Zn finger 245..262 CDD:275368 8/17 (47%)
C2H2 Zn finger 274..294 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 1/14 (7%)
zf-H2C2_2 315..339 CDD:290200 80/341 (23%)
C2H2 Zn finger 330..350 CDD:275368
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 20/85 (24%)
C2H2 Zn finger 144..164 CDD:275368 7/49 (14%)
C2H2 Zn finger 172..194 CDD:275368 7/22 (32%)
zf-H2C2_2 186..211 CDD:290200 11/25 (44%)
UFD2 <256..>294 CDD:227443 12/44 (27%)
C2H2 Zn finger 258..280 CDD:275368 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.