| Sequence 1: | NP_649798.3 | Gene: | CG7963 / 41001 | FlyBaseID: | FBgn0037584 | Length: | 354 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001163590.1 | Gene: | CG6813 / 41396 | FlyBaseID: | FBgn0037923 | Length: | 294 | Species: | Drosophila melanogaster | 
| Alignment Length: | 340 | Identity: | 80/340 - (23%) | 
|---|---|---|---|
| Similarity: | 133/340 - (39%) | Gaps: | 88/340 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    10 CRVCLKQDELLVDIY-----EIVEEMQ----VDLCTLLETCGGIKVDRRDVQPMYLCQECTNELL 65 
  Fly    66 IAAKFRKICVESEKLRDMAPEINID----TAEPLASEEI------IIIDPSDYIEQLSAVEDPEN 120 
  Fly   121 EPI--------------GVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGC 171 
  Fly   172 YQVHNCSYAKTPKRGHKC--LECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQ 234 
  Fly   235 RRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERP 299 
  Fly   300 YACQHRDKRFAQLGV 314  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG7963 | NP_649798.3 | zf-AD | 10..80 | CDD:285071 | 19/78 (24%) | 
| C2H2 Zn finger | 159..179 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | 184..>250 | CDD:227381 | 22/67 (33%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 7/21 (33%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 245..262 | CDD:275368 | 7/16 (44%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 1/13 (8%) | ||
| zf-H2C2_2 | 315..339 | CDD:290200 | 80/340 (24%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | |||
| CG6813 | NP_001163590.1 | zf-AD | 6..76 | CDD:285071 | 20/84 (24%) | 
| C2H2 Zn finger | 144..164 | CDD:275368 | 7/48 (15%) | ||
| C2H2 Zn finger | 172..194 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 186..211 | CDD:290200 | 11/24 (46%) | ||
| UFD2 | <256..>294 | CDD:227443 | 12/43 (28%) | ||
| C2H2 Zn finger | 258..280 | CDD:275368 | 9/21 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||