DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG8159

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster

Alignment Length:370 Identity:90/371 (24%)
Similarity:144/371 (39%) Gaps:86/371 (23%)


  Fly    10 CRVCLKQDELLVDIYEIVEEMQVDLCTLLETCG---GIKVDRRDVQPMYLCQECTNELLIAAKFR 71
            ||||...    .|..:.::......|.:|:...   |:.:......|.::|:.|..:|..|..||
  Fly     6 CRVCASS----TDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFR 66

  Fly    72 KICVESEKL----------------------------RDMAPEINIDTAEPLASEEIIIIDPSDY 108
            ..|:.|:|:                            .|.||:   ..|.||   |::|      
  Fly    67 DRCLRSQKIFEESLVRNEEDTFRSSVRRSARSQRQRHEDTAPK---TPASPL---EVMI------ 119

  Fly   109 IEQLSAVEDPENEPIGVSRW-NCQHCGAGFQLS-EVLRRHIQEVHASITIIDCRERRRIFTKLGC 171
              :|.::.:.:.|..|:... :|..  |..:|: :.:....::...:..:...|.|||...|.| 
  Fly   120 --KLESLSNGDEEDDGIDHLDSCNE--ADMELAIKAMSSSTEDDGTTSPVRLKRTRRRGLKKGG- 179

  Fly   172 YQVHNCSYAKTPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRR 236
             :..|.:....|.  ..|.:||..:...||...|:|.|:...||.|:.|...|.::|.|:.||..
  Fly   180 -KGENRTKVTLPV--FFCDQCGNNITGKSSFDRHLRKHSGIRPFQCELCPARFLSSGELKGHQVM 241

  Fly   237 HKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYA 301
            |....:.:|.:|.|.:|..|...|                             |.||:|.:||:.
  Fly   242 HTGDRKFQCRYCDRTYVNYSGRLR-----------------------------HERTHTNDRPFI 277

  Fly   302 CQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKH 346
            |....|.|....:||.|..|||||||.||::|.:.|.|...|:.|
  Fly   278 CAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTH 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 18/73 (25%)
C2H2 Zn finger 159..179 CDD:275368 7/20 (35%)
COG5048 184..>250 CDD:227381 20/66 (30%)
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..262 CDD:275368 6/17 (35%)
C2H2 Zn finger 274..294 CDD:275368 3/20 (15%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
zf-H2C2_2 315..339 CDD:290200 14/24 (58%)
C2H2 Zn finger 330..350 CDD:275368 6/18 (33%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 18/76 (24%)
C2H2 Zn finger 194..214 CDD:275368 7/20 (35%)
COG5048 <197..322 CDD:227381 48/154 (31%)
zf-H2C2_2 206..231 CDD:290200 9/25 (36%)
C2H2 Zn finger 222..242 CDD:275368 7/20 (35%)
C2H2 Zn finger 250..270 CDD:275368 9/49 (18%)
zf-H2C2_2 265..287 CDD:290200 10/51 (20%)
C2H2 Zn finger 278..298 CDD:275368 7/20 (35%)
zf-H2C2_2 291..315 CDD:290200 14/24 (58%)
C2H2 Zn finger 306..328 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.