DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and ouib

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:354 Identity:89/354 - (25%)
Similarity:143/354 - (40%) Gaps:79/354 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCLKQD--ELLVDIYEIVEEMQVDLCTLLETCGGIK-VDRRDVQPMYLCQECTNELLIAAKFR 71
            ||||.:|.  |..::::::|....:   ..|....|:: ||..|| |.::|..|..||..|..||
  Fly     6 CRVCGRQKICEKSLNLFDLVNRKYL---KHLHMISGLRLVDLDDV-PGFMCLCCQAELRSALAFR 66

  Fly    72 KICVESE----KLRDMAPEINIDTAE--PLASEEIIIID-----PSDYIEQLSAV---EDPENEP 122
            |:|::::    .:.|.:...:.||.:  .|.||:....|     ..:.:|:...|   |:|.:: 
  Fly    67 KLCIKTQTKWLTIEDDSSSGDEDTNDNSELESEKCAFSDFGKKKEGELVEETFQVLIEEEPMDK- 130

  Fly   123 IGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGH 187
                           .|:...:..::|.......:..::..::.|||. .|::.|..        
  Fly   131 ---------------TLNRDAKAQLREDGIDEKCVPSQKIIKVSTKLD-DQIYICEL-------- 171

  Fly   188 KCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGF 252
                ||....|..:...|:|.|..|.||.|..|...|.:.|.|..|.|                 
  Fly   172 ----CGTHATSKPTFQRHMRKHRGERPFGCKDCDARFLSAGELRAHHR----------------- 215

  Fly   253 VESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKI 317
                        .||.|:|..|...::.:.......:|.||:|.:|||.|:...|:|....|||.
  Fly   216 ------------VHTGEQPFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKN 268

  Fly   318 HERIHTGERLHRCQVCEKPFTRAGQLRKH 346
            |..||||||..||.:|::.|.|...|..|
  Fly   269 HMVIHTGERNFRCDICDRSFQRKAHLVTH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 23/76 (30%)
C2H2 Zn finger 159..179 CDD:275368 5/19 (26%)
COG5048 184..>250 CDD:227381 16/65 (25%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..262 CDD:275368 0/16 (0%)
C2H2 Zn finger 274..294 CDD:275368 3/19 (16%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..339 CDD:290200 13/23 (57%)
C2H2 Zn finger 330..350 CDD:275368 6/17 (35%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871 23/75 (31%)
COG5048 <158..300 CDD:227381 53/182 (29%)
C2H2 Zn finger 169..189 CDD:275368 6/31 (19%)
C2H2 Zn finger 197..217 CDD:275368 7/48 (15%)
zf-H2C2_2 209..234 CDD:290200 8/53 (15%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
zf-H2C2_2 241..262 CDD:290200 10/20 (50%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..288 CDD:290200 12/21 (57%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.