DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG17328

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_609786.2 Gene:CG17328 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster

Alignment Length:345 Identity:90/346 (26%)
Similarity:132/346 (38%) Gaps:78/346 (23%)


  Fly    10 CRVCLKQDELLVDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQECTNELLIAAKFRKIC 74
            |||||::...:..||.....|...:  :|..|..|:|.:.|..|..:|..|...|.:|..|::.|
  Fly     9 CRVCLEELHPVTSIYSTDFAMMPSV--MLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQEC 71

  Fly    75 VESE-KLRDMAPEINIDTAEPLASEEIIIIDPSDYIEQ--LSAVEDPENEPIG--VSRWNCQHCG 134
            ..|: :||..   :.|     |.|........:|::|:  |...:..|.||:.  ||:...::  
  Fly    72 ENSDLRLRQY---LGI-----LESWRQDAATNTDFVEKPLLPQRDSDEEEPVDAKVSKRRSRY-- 126

  Fly   135 AGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCLECGKCLQSA 199
                     :|...|.|               .|.|...|        ||..|.|.||.|..:..
  Fly   127 ---------QRKPPEEH---------------KKRGPKPV--------PKMPHTCYECHKSFKCI 159

  Fly   200 SSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIVN 264
            :.|..|||.||.|.|:.|..|.:.|.....|:||:|                             
  Fly   160 AQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHER----------------------------- 195

  Fly   265 RHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERIHTGERLHR 329
            .||.::|..|.:..:.||.:...:.|.:.:.|.|...|....|.|...|.|..|...|||.:.|.
  Fly   196 THTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHH 260

  Fly   330 CQVCEKPFTRAGQLRKHALR 349
            |.||.|.|:|...:|.|.|:
  Fly   261 CDVCGKAFSRRRDMRTHKLK 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 21/71 (30%)
C2H2 Zn finger 159..179 CDD:275368 3/20 (15%)
COG5048 184..>250 CDD:227381 21/66 (32%)
C2H2 Zn finger 189..209 CDD:275368 8/20 (40%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..262 CDD:275368 0/17 (0%)
C2H2 Zn finger 274..294 CDD:275368 4/20 (20%)
C2H2 Zn finger 302..322 CDD:275368 6/20 (30%)
zf-H2C2_2 315..339 CDD:290200 11/24 (46%)
C2H2 Zn finger 330..350 CDD:275368 9/21 (43%)
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 23/73 (32%)
COG5048 146..>211 CDD:227381 24/94 (26%)
C2H2 Zn finger 149..169 CDD:275368 8/20 (40%)
zf-H2C2_2 162..186 CDD:290200 11/24 (46%)
C2H2 Zn finger 177..197 CDD:275368 7/49 (14%)
zf-H2C2_2 189..213 CDD:290200 9/53 (17%)
C2H2 Zn finger 205..225 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 6/20 (30%)
zf-H2C2_2 245..270 CDD:290200 11/25 (44%)
C2H2 Zn finger 261..282 CDD:275368 9/21 (43%)
C2H2 Zn finger 318..338 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.