DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and CG11696

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster

Alignment Length:350 Identity:85/350 (24%)
Similarity:135/350 (39%) Gaps:82/350 (23%)


  Fly    21 VDIYEIVEEMQVDLCTLLETCGGIKVDRRDVQPMYLCQ-ECTNELLIAAKFRKICVESEKLRDMA 84
            :|.| |...:::| |.:   |.....|..|::..:..: :||.       :.|.|....|.|.: 
  Fly   290 MDDY-IAANVKLD-CAI---CAAPLEDFNDLKRHFRVEHDCTG-------YVKCCNNRYKKRTL- 341

  Fly    85 PEINIDTAEPLASEEIIIIDPSDYIEQLSAVEDPENEPIGVSRWNCQHCGAGF-----QLSEVLR 144
                                   |::.|...:||:       .::||.|...|     |:..:||
  Fly   342 -----------------------YVDHLHCHKDPQ-------YFSCQSCRKNFLNRNSQVMHMLR 376

  Fly   145 RHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHK-------CLECGKCLQSASSL 202
            .|.|:.........|..|   |.|.....:|        .:|||       |..|.|..::...|
  Fly   377 FHSQQQELVHQCAICEAR---FAKKFLLTMH--------LKGHKGTERPEVCDTCSKTFRTKFEL 430

  Fly   203 ASHI-RLH-TDEWPFTCDQCAKAFRTNGALEVHQRR-HKQ--VLQHKCLHCGRGFVESSNLRRHI 262
            ::|: |:| .|..|..||.|...||:.....:|::. |..  |.:.:|..|||...:..:||:|:
  Fly   431 SAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHL 495

  Fly   263 VNRH------TEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERI 321
            . ||      |:.|..|||..:.|.:   .|..|:|.:...:.:.|...||.|.....|..|...
  Fly   496 A-RHDDRDGDTKYRCLLCNAEKSSRA---ALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMAT 556

  Fly   322 HTGERLHRCQVCEKPFTRAGQLRKH 346
            |||..|::||.|.:.|.....:..|
  Fly   557 HTGIDLYQCQFCTRTFKSHANMHNH 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 13/60 (22%)
C2H2 Zn finger 159..179 CDD:275368 5/20 (25%)
COG5048 184..>250 CDD:227381 23/78 (29%)
C2H2 Zn finger 189..209 CDD:275368 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/21 (29%)
C2H2 Zn finger 245..262 CDD:275368 7/17 (41%)
C2H2 Zn finger 274..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 6/20 (30%)
zf-H2C2_2 315..339 CDD:290200 10/24 (42%)
C2H2 Zn finger 330..350 CDD:275368 5/17 (29%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 5/41 (12%)
C2H2 Zn finger 357..378 CDD:275368 7/21 (33%)
C2H2 Zn finger 388..408 CDD:275368 6/31 (19%)
C2H2 Zn finger 417..438 CDD:275368 6/21 (29%)
C2H2 Zn finger 447..465 CDD:275368 6/18 (33%)
C2H2 Zn finger 478..498 CDD:275368 8/21 (38%)
C2H2 Zn finger 509..529 CDD:275368 7/23 (30%)
C2H2 Zn finger 537..557 CDD:275368 6/20 (30%)
C2H2 Zn finger 565..583 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.