DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and klf-3

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans

Alignment Length:111 Identity:36/112 (32%)
Similarity:55/112 (49%) Gaps:13/112 (12%)


  Fly   254 ESSNLRRHIVNRHTEERP-------HLCNVYQ---RSFSRVYMLELHLRTNTGERPYAC--QHRD 306
            |.|.|:|.......:..|       |.| .|.   :.:|:...|:.|.||::||:|:.|  |:..
 Worm   205 ERSPLQRKSRIESNKRNPTDKKFVVHAC-TYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCS 268

  Fly   307 KRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHET 352
            .:||:...|..|.|.|||::..||.:|::.|.|:..|..|..||.|
 Worm   269 WKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHST 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368
COG5048 184..>250 CDD:227381
C2H2 Zn finger 189..209 CDD:275368
C2H2 Zn finger 217..237 CDD:275368
C2H2 Zn finger 245..262 CDD:275368 4/8 (50%)
C2H2 Zn finger 274..294 CDD:275368 7/23 (30%)
C2H2 Zn finger 302..322 CDD:275368 7/22 (32%)
zf-H2C2_2 315..339 CDD:290200 10/24 (42%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..284 CDD:275368 7/22 (32%)
zf-H2C2_2 276..301 CDD:290200 10/25 (40%)
C2H2 Zn finger 292..312 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.