DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and lsy-2

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001024696.1 Gene:lsy-2 WormBaseID:WBGene00003087 Length:365 Species:Caenorhabditis elegans

Alignment Length:220 Identity:57/221 (26%)
Similarity:83/221 (38%) Gaps:54/221 (24%)


  Fly   182 TPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCL 246
            ||:..|:|..|.|...|...|..|..:|||:.||.||.|:|:||....|..|:..|.....|.|.
 Worm    73 TPRAVHQCNVCNKIFVSYKGLQQHAVIHTDQKPFRCDICSKSFRFKSNLFEHRSVHTGFTPHACP 137

  Fly   247 HCGRGFVESSNLRRHIVNRHT--EE-----RPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQH 304
            :||:......||::|:....|  ||     ||...|  :|..:.:....:.||...|  ||....
 Worm   138 YCGKTCRLKGNLKKHLRTHVTTKEELEAAWRPFASN--RRPPADIPDDAIVLRGAGG--PYYTPP 198

  Fly   305 RDKRFAQLGV------------------LKIHERIHTGE------------------------RL 327
            ...:..:||:                  :::.::|...|                        ..
 Worm   199 PRPKKKKLGLGEPEHWVDKLRRGDLLPQVELEDKIRRLEDTIFNNMSLERWGNLFEIAKSIAFET 263

  Fly   328 HRCQVCEKPF-TRAGQLRKHALRHE 351
            |.|.||:..| ||...:..|.|.||
 Worm   264 HDCPVCKSQFMTRMDCVSHHTLEHE 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368
COG5048 184..>250 CDD:227381 25/66 (38%)
C2H2 Zn finger 189..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
C2H2 Zn finger 245..262 CDD:275368 6/17 (35%)
C2H2 Zn finger 274..294 CDD:275368 4/20 (20%)
C2H2 Zn finger 302..322 CDD:275368 3/38 (8%)
zf-H2C2_2 315..339 CDD:290200 8/49 (16%)
C2H2 Zn finger 330..350 CDD:275368 8/21 (38%)
lsy-2NP_001024696.1 C2H2 Zn finger 80..100 CDD:275368 6/20 (30%)
zf-H2C2_2 93..115 CDD:290200 11/22 (50%)
COG5048 102..>156 CDD:227381 19/54 (35%)
zf-C2H2 106..128 CDD:278523 9/22 (41%)
C2H2 Zn finger 108..128 CDD:275368 8/20 (40%)
zf-C2H2 134..156 CDD:278523 7/22 (32%)
C2H2 Zn finger 136..156 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.