DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and eor-1

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_500645.1 Gene:eor-1 WormBaseID:WBGene00001324 Length:909 Species:Caenorhabditis elegans

Alignment Length:288 Identity:78/289 (27%)
Similarity:122/289 (42%) Gaps:51/289 (18%)


  Fly   103 IDPSDYIEQLSAVEDPENEPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITIIDCR--ERRRI 165
            :||.|       .||.|::|.......|..||......|:|.:|....|...|...|.  |....
 Worm   406 LDPDD-------CEDEEDQPDENGPSTCIFCGLRTANEELLEKHKARHHNRNTYYMCHLCEFETN 463

  Fly   166 FTKLGCYQVHNCS--YAKTPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNG 228
            ::|.  :.:| |:  :.:.|   ::|..|...........:|...||||..|.|.:||...||..
 Worm   464 WSKQ--FYLH-CAEHWTEIP---YRCETCPFTSNEIQEFLTHRLQHTDERFFKCGECAWKGRTRS 522

  Fly   229 ALEVHQRRHKQVLQHKCLH---CGRGFVESSNLRRHIVNRHTEERPHLC-------------NVY 277
            .|..|:|.| .||..:.||   |||||.:.|.|..|:.: |.:.||::|             :::
 Worm   523 QLFAHERMH-SVLDDRSLHCEECGRGFQQHSTLDHHVAS-HNDPRPYICEDCGFATKTADHLSLH 585

  Fly   278 QR----------------SFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERIHTGER 326
            :|                |.::...|..||||:...|.:.|:...:.|.:...|..|||||..|:
 Worm   586 RRQHTGDNFSCHIAGCDYSSTKKSQLAAHLRTHMAVRAHLCKICGRGFIEKSHLVRHERIHLEEK 650

  Fly   327 LHRCQVCEKPFTRAGQLRKHALRHETGQ 354
            ..:|..||...:|..:|::|.::|...:
 Worm   651 PFKCDQCEYASSRRDKLKEHIIKHHNSE 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368 5/24 (21%)
COG5048 184..>250 CDD:227381 23/69 (33%)
C2H2 Zn finger 189..209 CDD:275368 3/20 (15%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
C2H2 Zn finger 245..262 CDD:275368 10/20 (50%)
C2H2 Zn finger 274..294 CDD:275368 8/49 (16%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
zf-H2C2_2 315..339 CDD:290200 10/24 (42%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
eor-1NP_500645.1 BTB 32..134 CDD:279045
BTB 43..137 CDD:197585
BACK 142..242 CDD:197943
C2H2 Zn finger 455..475 CDD:275368 5/23 (22%)
zf-C2H2_8 <481..527 CDD:292531 14/46 (30%)
C2H2 Zn finger 483..503 CDD:275368 3/20 (15%)
C2H2 Zn finger 511..531 CDD:275368 8/20 (40%)
C2H2 Zn finger 541..561 CDD:275368 8/21 (38%)
C2H2 Zn finger 569..589 CDD:275368 2/20 (10%)
C2H2 Zn finger 601..618 CDD:275368 6/17 (35%)
C2H2 Zn finger 626..646 CDD:275368 7/20 (35%)
zf-H2C2_2 638..663 CDD:290200 10/25 (40%)
C2H2 Zn finger 654..674 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.