DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7963 and klf-1

DIOPT Version :9

Sequence 1:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_497632.1 Gene:klf-1 / 175404 WormBaseID:WBGene00018990 Length:497 Species:Caenorhabditis elegans


Alignment Length:298 Identity:74/298 - (24%)
Similarity:105/298 - (35%) Gaps:104/298 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CVESE----KLRDMAPEINIDTAEPLASEEIIIIDPSDYIEQLSAVED-PENEPIGVSRWNCQHC 133
            ||:..    .|||          |||...          :|.:|:..| |.:....|:.:..|: 
 Worm   282 CVKRSAMNFDLRD----------EPLTVN----------VESVSSTSDLPSSVSSSVNSFVYQN- 325

  Fly   134 GAGFQLSEVLRRHIQEVHASITII---DCR---ERRRIFTKLGC----YQVHNCSYAKTPKRGH- 187
               |...| .:|.|.|:.||..:.   |..   :...|.|:|..    .:.|....|:..:|.| 
 Worm   326 ---FDPLE-FKRKIDELTASACLAVMPDANGQVDPMAIKTQLDAIKKQMEEHQTHMAEASQRLHV 386

  Fly   188 -KCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQHKCLH--CG 249
             ..||...|..|.||                        :..|.|...:|     .|.|.|  ||
 Worm   387 DSSLEDSNCEPSPSS------------------------SYDASEPSVKR-----LHHCTHPNCG 422

  Fly   250 RGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHR--DKRFAQL 312
            :.:.:||:|:                             .|.||:|||:||.|...  |.|||:.
 Worm   423 KVYTKSSHLK-----------------------------AHFRTHTGEKPYECSWDGCDWRFARS 458

  Fly   313 GVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRH 350
            ..|..|.|.|||:|..:|..|.:.|:|:..|..|..||
 Worm   459 DELTRHYRKHTGDRPFKCSQCSRAFSRSDHLSLHMKRH 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 2/9 (22%)
C2H2 Zn finger 159..179 CDD:275368 4/26 (15%)
COG5048 184..>250 CDD:227381 15/69 (22%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..237 CDD:275368 2/19 (11%)
C2H2 Zn finger 245..262 CDD:275368 7/18 (39%)
C2H2 Zn finger 274..294 CDD:275368 2/19 (11%)
C2H2 Zn finger 302..322 CDD:275368 8/21 (38%)
zf-H2C2_2 315..339 CDD:290200 10/23 (43%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
klf-1NP_497632.1 COG5048 398..>481 CDD:227381 36/140 (26%)
C2H2 Zn finger 419..438 CDD:275368 7/47 (15%)
zf-H2C2_2 430..457 CDD:290200 13/55 (24%)
C2H2 Zn finger 446..468 CDD:275368 8/21 (38%)
zf-H2C2_2 460..485 CDD:290200 10/24 (42%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.