DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and klf-1

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_497632.1 Gene:klf-1 WormBaseID:WBGene00018990 Length:497 Species:Caenorhabditis elegans

Alignment Length:311 Identity:72/312 (23%)
Similarity:108/312 (35%) Gaps:111/312 (36%)


  Fly    88 NIDTAEPLASE------EIIIIDPSDY-------------------------IEQLSAVED-PEN 120
            |.|.|...:.:      |.|:::.:|.                         :|.:|:..| |.:
 Worm   249 NFDIASSSSGDSGHQDHESIVVEDADMDSPTSPCVKRSAMNFDLRDEPLTVNVESVSSTSDLPSS 313

  Fly   121 EPIGVSRWNCQHCGAGFQLSEVLRRHIQEVHASITII---DCR---ERRRIFTKLGC----YQVH 175
            ....|:.:..|:    |...| .:|.|.|:.||..:.   |..   :...|.|:|..    .:.|
 Worm   314 VSSSVNSFVYQN----FDPLE-FKRKIDELTASACLAVMPDANGQVDPMAIKTQLDAIKKQMEEH 373

  Fly   176 NCSYAKTPKRGH--KCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHK 238
            ....|:..:|.|  ..||...|..|.||                        :..|.|...:|  
 Worm   374 QTHMAEASQRLHVDSSLEDSNCEPSPSS------------------------SYDASEPSVKR-- 412

  Fly   239 QVLQHKCLH--CGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYA 301
               .|.|.|  ||:.:.:||:|:                             .|.||:|||:||.
 Worm   413 ---LHHCTHPNCGKVYTKSSHLK-----------------------------AHFRTHTGEKPYE 445

  Fly   302 CQHR--DKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRH 350
            |...  |.|||:...|..|.|.|||:|..:|..|.:.|:|:..|..|..||
 Worm   446 CSWDGCDWRFARSDELTRHYRKHTGDRPFKCSQCSRAFSRSDHLSLHMKRH 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368 4/27 (15%)
COG5048 184..>250 CDD:227381 16/70 (23%)
C2H2 Zn finger 189..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 217..237 CDD:275368 3/20 (15%)
C2H2 Zn finger 245..262 CDD:275368 7/19 (37%)
C2H2 Zn finger 274..294 CDD:275368 3/20 (15%)
C2H2 Zn finger 302..322 CDD:275368 8/22 (36%)
zf-H2C2_2 315..339 CDD:290200 10/24 (42%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
klf-1NP_497632.1 COG5048 398..>481 CDD:227381 36/141 (26%)
C2H2 Zn finger 419..438 CDD:275368 8/48 (17%)
zf-H2C2_2 430..457 CDD:290200 14/56 (25%)
C2H2 Zn finger 446..468 CDD:275368 8/22 (36%)
zf-H2C2_2 460..485 CDD:290200 10/25 (40%)
C2H2 Zn finger 476..496 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.