DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and hic1

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_004911693.1 Gene:hic1 XenbaseID:XB-GENE-989486 Length:664 Species:Xenopus tropicalis

Alignment Length:306 Identity:68/307 (22%)
Similarity:116/307 (38%) Gaps:96/307 (31%)


  Fly    76 ESEKLRDMAPEINIDTAE--PLASE----EIIIIDPSD---YIEQLSAVEDPENEPIGVSRWNCQ 131
            ||::.:|:..|   |..|  ||:.:    .|...:|.|   ..|...:.||| :....:.|::|.
 Frog   335 ESDREKDLDRE---DKGESSPLSQQPRYPSIESNEPDDDKSTSEDTGSSEDP-SPSSNLERYHCN 395

  Fly   132 HCGAGFQLSEVLRRHIQEVHASITIIDCRERRRIFTKLGCYQVHNCSYAKTPKRGHKCLECGKCL 196
            |.|                                     |:..:..     ...:.|:.|||..
 Frog   396 HLG-------------------------------------YEPESFG-----DNLYVCIPCGKGF 418

  Fly   197 QSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQ------------------- 242
            .|:..|.:|:..|.:|                  |::   ||:.::                   
 Frog   419 PSSEQLNAHVEAHNEE------------------ELY---HKESMEPPVQFLDKSSQGLSDMIRP 462

  Fly   243 HKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDK 307
            ::|..|.:.:.:.:.||:| ...|...||:.||:..:.|::...:..|:|::.|.:|:||.....
 Frog   463 YRCSSCDKSYKDPATLRQH-EKTHWLTRPYPCNICGKKFTQRGTMTRHMRSHLGLKPFACDACGM 526

  Fly   308 RFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHETG 353
            ||.:...|..|.|||:||:.:.||||...|.:...|..|...|.||
 Frog   527 RFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHTTG 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 2/4 (50%)
C2H2 Zn finger 159..179 CDD:275368 1/20 (5%)
COG5048 184..>250 CDD:227381 14/85 (16%)
C2H2 Zn finger 189..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 217..237 CDD:275368 1/20 (5%)
C2H2 Zn finger 245..262 CDD:275368 5/17 (29%)
C2H2 Zn finger 274..294 CDD:275368 5/20 (25%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
zf-H2C2_2 315..339 CDD:290200 12/24 (50%)
C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
hic1XP_004911693.1 BTB 40..144 CDD:279045
BTB 51..146 CDD:197585
C2H2 Zn finger 411..431 CDD:275368 7/20 (35%)
C2H2 Zn finger 465..485 CDD:275368 5/21 (24%)
zf-H2C2_2 478..502 CDD:290200 9/25 (36%)
zf-C2H2 491..513 CDD:278523 5/22 (23%)
C2H2 Zn finger 493..513 CDD:275368 5/20 (25%)
zf-H2C2_2 506..530 CDD:290200 8/24 (33%)
COG5048 517..>565 CDD:227381 18/48 (38%)
C2H2 Zn finger 521..541 CDD:275368 7/20 (35%)
zf-H2C2_2 534..558 CDD:290200 12/24 (50%)
C2H2 Zn finger 549..569 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.