DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7963 and zgc:174623

Sequence 1:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001107949.1 Gene:zgc:174623 ZFINID:ZDB-GENE-080219-5 Length:276 Species:Danio rerio

Alignment Length:251 Identity:92/252 (37%)
Similarity:134/252 (53%) Gaps:29/252 (12%)


  Fly   130 CQHCGAGFQLSEVLRRHIQEVHAS---ITIIDCRERRRIFTKLG-------------CYQ----- 173
            |..||........|:||:: :|..   .|...|.:..|..:.|.             |.|     
Zfish    27 CTQCGRSLANKRSLQRHMR-IHTGEKPFTCTQCGKSLRSLSNLNYHMMTHSGERPFTCSQCGMSF 90

  Fly   174 -----VHNCSYAKTPKRGHKCLECGKCLQSASSLASHIRLHTDEWPFTCDQCAKAFRTNGALEVH 233
                 ::|.....|.::.|||.:|||....||.|.||.|:||:|.|::|..|.|:||...:|.:|
Zfish    91 RQSSNLNNHMLIHTGEKTHKCDQCGKTFFRASDLKSHFRVHTEEKPYSCSLCGKSFRHRESLRIH 155

  Fly   234 QRRHKQVLQHKCLHCGRGFVESSNLRRHIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGER 298
            ::.|..|.::||..|.:.|....:|:.| ...||.|:|::|:|..||||....|::|:|.:|||:
Zfish   156 EKIHTGVREYKCSECEKTFYSDEHLKLH-ERTHTGEKPYICSVCIRSFSHFEHLKIHVRIHTGEK 219

  Fly   299 PYACQHRDKRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKHALRHETGQ 354
            ||.|.|.||||.||.|||.||||||||:.::|..|:|.|.:...|::|...| ||:
Zfish   220 PYKCSHCDKRFRQLVVLKRHERIHTGEKPYKCSHCDKRFIQLESLKRHKRIH-TGE 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368 6/43 (14%)
COG5048 184..>250 CDD:227381 28/66 (42%)
C2H2 Zn finger 189..209 CDD:275368 10/20 (50%)
C2H2 Zn finger 217..237 CDD:275368 7/20 (35%)
C2H2 Zn finger 245..262 CDD:275368 5/17 (29%)
C2H2 Zn finger 274..294 CDD:275368 9/20 (45%)
C2H2 Zn finger 302..322 CDD:275368 15/20 (75%)
zf-H2C2_2 315..339 CDD:290200 14/24 (58%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
zgc:174623NP_001107949.1 C2H2 Zn finger 27..47 CDD:275368 6/21 (29%)
zf-H2C2_2 39..61 CDD:290200 6/23 (26%)
COG5048 <52..269 CDD:227381 82/218 (38%)
C2H2 Zn finger 55..75 CDD:275368 3/20 (15%)
C2H2 Zn finger 83..103 CDD:275368 3/20 (15%)
C2H2 Zn finger 111..131 CDD:275368 10/20 (50%)
C2H2 Zn finger 139..159 CDD:275368 7/20 (35%)
C2H2 Zn finger 167..187 CDD:275368 5/21 (24%)
C2H2 Zn finger 195..215 CDD:275368 9/20 (45%)
zf-H2C2_2 207..232 CDD:290200 14/25 (56%)
C2H2 Zn finger 223..243 CDD:275368 15/20 (75%)
zf-H2C2_2 236..260 CDD:290200 14/24 (58%)
C2H2 Zn finger 251..271 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.