DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7352 and mns1

Sequence 1:NP_649795.1 Gene:CG7352 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_009301508.1 Gene:mns1 ZFINID:ZDB-GENE-030521-42 Length:503 Species:Danio rerio

Alignment Length:465 Identity:119/466 (26%)
Similarity:214/466 (46%) Gaps:63/466 (14%)


  Fly    24 QVPHSLRKEHDFFSSQLFRKLQYD-----LEEVSRSQELSKVSPITRDFIEEAAMTQEMQDLKRA 83
            |:..:|..|......:|.||||.:     :||.....|..|:.. .|...:|..|.:|:..:...
Zfish    41 QLEANLSCEDRIERKRLLRKLQDEEYGKQIEESLLRAEEDKLFR-ERQLEQEERMAKELARINNE 104

  Fly    84 EFVERKRRQQLRRDCEELRDLAEQLRLAAISRDIAENLEEKKRRRQLDIKLE---AAEVSQERCL 145
            :..:.|.||.::.:..|||:|..:|:.|.::|:.|..:.||:..|...::.|   |..:..|..|
Zfish   105 KLRDEKMRQYIKENSVELRELELKLKSAYLNRERAAQMAEKEAMRYETLREEAMIARTMRDEHEL 169

  Fly   146 LEVRQREKEVALKEEQRRLRESLAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDRAQELE 210
            .|:.:.:.|....||..|.::.|..|:||..|:|.:.:.:.:.::.:...:.::|..||: .||:
Zfish   170 AEMEKEKLEQKKYEEVVRYQQELERQLEEKERKRQEAYEEFLKEKHMVDEIVRKIYMEDQ-MELQ 233

  Fly   211 AQRKKLQKRQDMLRSIKENQELREWQRAQ------YNQELSDLVQKQSDMERRKLQLEAERQEIQ 269
            .|..|::..|..:...|:.|  .||:|.:      .|:.:.:..|.|...|..::   |:.:|.:
Zfish   234 LQLDKMKATQRYIEDFKKQQ--AEWRRMEREKVEAENRRIIEFAQYQQRKEEDRM---AKVRERE 293

  Fly   270 RKKQEISIRLGQQVLEIENKKRH-----RDNLLLDLLEAEYTAKSDERYRQQMQQEQMSRQRTRQ 329
            :.|:.:...|.:|: |:|.::|.     |:.|.|:        :..|..|||..:|...|.|.|.
Zfish   294 QAKETLHKMLSEQI-ELEKQQREKMERAREELCLE--------EQAEAARQQEIEEMEKRIRQRL 349

  Fly   330 ELDRYRQE-VKHRKMAEMQMKRAEMATRQEEAPDTINQNSEKQLDEYRRRRAHGASLLAMIEDNH 393
            ||.:.:|| :..:|:...:.|..|.|.||.........:..:|::..:||         |.:..|
Zfish   350 ELQQTQQEMMAFKKLRLQEEKEEEEAFRQTMMAKFAEDDRIEQMNAQKRR---------MKQLEH 405

  Fly   394 RKRAEATAE--NVQYFDMKAKIDAEQEER-------------IKQERLAMLSQVPSSVLRYLPKH 443
            ::..|...|  ..||.   |:.:.|::||             |::||..:|.|..:.:|.||||.
Zfish   406 KRAVEQLLEERRQQYL---AEQEREEQERAVELEREAQRRRIIEEERQRLLKQHATKLLGYLPKG 467

  Fly   444 VLKSTDREHF 453
            :.|..|.|||
Zfish   468 IFKEEDLEHF 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 91/372 (24%)
mns1XP_009301508.1 TPH 115..466 CDD:316391 94/378 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JVC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D449210at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130109
Panther 1 1.100 LDO PTHR19265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.