DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7352 and cfap53

Sequence 1:NP_649795.1 Gene:CG7352 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001038595.2 Gene:cfap53 ZFINID:ZDB-GENE-060503-508 Length:519 Species:Danio rerio

Alignment Length:521 Identity:119/522 (23%)
Similarity:214/522 (41%) Gaps:151/522 (29%)


  Fly    52 SRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQQLRRDCEEL----RDLAEQLRLAA 112
            :.|..|....|::|| |::..:.:..|:..|.|.:|..:.|.   .|:..    |:...::..|.
Zfish    18 AHSVALKARPPLSRD-IDDIFVRRRKQEATRGEVLEFTKDQS---SCDVRMRWERNTQRRVVSAT 78

  Fly   113 ISRDIAENL--------EEKKRRRQLDIKLEAAEVSQERCLLEVRQREKEVALKEEQRRLRE--- 166
            ::|.:.:.|        |:::|.|:|   ||:.|:.    |.:..:.:||..| |.|.::.|   
Zfish    79 VNRHLQDALDQYQMGIDEKRERLREL---LESEELE----LFKEMEAKKETVL-ERQAKMHEGAK 135

  Fly   167 SLAEQMEENRRR-----------------------RLQEHAQVMNDRELSLLMQ---KQIQEEDR 205
            :|.|:.|..|:|                       |.|:  ||..:||..:..:   :::|||:.
Zfish   136 TLRERRESERQRVVADKLDQLFREQSEELRAVQIKRRQD--QVCTERESQIRTKEEVRRVQEEEE 198

  Fly   206 ---AQELEAQRKKLQKRQDM-LRSIKEN-----------QELREWQRAQ---YNQELSDLVQKQS 252
               ||..|:.|...::|.:: |:..:||           .::.|.||.|   ..||.:.|::.|.
Zfish   199 KLFAQMWESDRLAKEERHNLELQRQRENNLQQKAVLQTQMDMAEQQRIQAKELKQEEAQLLKDQR 263

  Fly   253 DMERRKLQLEAER--------QEIQRKKQEISIRLGQQVLEIENKKRHRDNLLLD------LLEA 303
            :|    |:|||||        ||.:||:.::|:||..:.|    .:..::.|.||      ||..
Zfish   264 EM----LRLEAEREHRQKLQDQEKRRKQLDLSLRLKMKRL----TRDRQEELALDMSILEQLLAQ 320

  Fly   304 EYTAKSDE------------RYR----QQMQQEQMSRQRTRQELDRYRQEVKHRKMAEMQMKRAE 352
            |...|.||            |||    ||:::::.....|.|..:...|:...|:.|:.::::..
Zfish   321 EKDEKQDEVLKKLERQEEQRRYREYLTQQLEEQKRLEAETEQLFESELQQAWARREAQWRLEKTA 385

  Fly   353 MATRQEEAPDT--------INQNSEKQLDEYRRR-----------------RAH--------GAS 384
            .....::..||        :|:|.:||.:.::.:                 :||        .|.
Zfish   386 RDRLMKDVMDTLRLQIQEKLNENMQKQAEAFKEKEELDRIIQANKLLDEEEKAHFREATKEYQAD 450

  Fly   385 LLAMIEDNHRKRAEATAENVQYFDMKAKIDAEQEERIKQERLAMLSQVPSSVLRYLPKHVLKSTD 449
            |||.:....|.|....||....|......:.:..::|:.    :||:..||....   |..:..|
Zfish   451 LLAQMMYRQRIREAEEAEKEYEFQKGLMYEEQYNKKIQD----ILSRPISSTTAV---HPFRRRD 508

  Fly   450 R 450
            |
Zfish   509 R 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 105/464 (23%)
cfap53NP_001038595.2 TPH 160..493 CDD:290579 79/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.