| Sequence 1: | NP_649795.1 | Gene: | CG7352 / 40997 | FlyBaseID: | FBgn0037581 | Length: | 466 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001038595.2 | Gene: | cfap53 / 567344 | ZFINID: | ZDB-GENE-060503-508 | Length: | 519 | Species: | Danio rerio |
| Alignment Length: | 520 | Identity: | 120/520 - (23%) |
|---|---|---|---|
| Similarity: | 215/520 - (41%) | Gaps: | 149/520 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 52 SRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQ---QLRRDCEELRDLAEQLRLAAI 113
Fly 114 SRDIAENL--------EEKKRRRQLDIKLEAAEVSQERCLLEVRQREKEVALKEEQRRLRE---S 167
Fly 168 LAEQMEENRRR-----------------------RLQEHAQVMNDRELSLLMQ---KQIQEEDR- 205
Fly 206 --AQELEAQRKKLQKRQDM-LRSIKEN-----------QELREWQRAQ---YNQELSDLVQKQSD 253
Fly 254 MERRKLQLEAER--------QEIQRKKQEISIRLGQQVLEIENKKRHRDNLLLD------LLEAE 304
Fly 305 YTAKSDE------------RYR----QQMQQEQMSRQRTRQELDRYRQEVKHRKMAEMQMKRAEM 353
Fly 354 ATRQEEAPDT--------INQNSEKQLDEYRRR-----------------RAH--------GASL 385
Fly 386 LAMIEDNHRKRAEATAENVQYFDMKAKIDAEQEERIKQERLAMLSQVPSSVLRYLPKHVLKSTDR 450
Fly 451 450 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7352 | NP_649795.1 | TPH | 97..439 | CDD:290579 | 105/459 (23%) |
| cfap53 | NP_001038595.2 | TPH | 160..493 | CDD:290579 | 78/346 (23%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 498..519 | 3/15 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||