DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7352 and MNS1

Sequence 1:NP_649795.1 Gene:CG7352 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_060835.1 Gene:MNS1 HGNCID:29636 Length:495 Species:Homo sapiens

Alignment Length:450 Identity:110/450 (24%)
Similarity:221/450 (49%) Gaps:71/450 (16%)


  Fly    39 QLFRKLQ-----YDLEE-VSRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQQLRRD 97
            |..|.||     .|:|| :.:::|..::..:  ...:|..:..|:..||.....:.|.|||:|.:
Human    55 QFLRLLQNEQFELDMEEAIQKAEENKRLKEL--QLKQEEKLAMELAKLKHESLKDEKMRQQVREN 117

  Fly    98 CEELRDLAEQLRLAAISRDIAENLEEKKRRRQLDIKLEAAEVSQERCLLEVRQR--EKEVALKEE 160
            ..|||:|.::|:.|.::::.|..:.||...:...:|.: ||::  :.::|..:|  ::|.|.:::
Human   118 SIELRELEKKLKAAYMNKERAAQIAEKDAIKYEQMKRD-AEIA--KTMMEEHKRIIKEENAAEDK 179

  Fly   161 QRRLRE----SLAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDRAQELEAQRKKLQKRQD 221
            :.:.:.    .|.:|:||..:::.:.:.|::.::.:...:.::|.|||   :||.| :||:|...
Human   180 RNKAKAQYYLDLEKQLEEQEKKKQEAYEQLLKEKLMIDEIVRKIYEED---QLEKQ-QKLEKMNA 240

  Fly   222 MLRSIKENQELREWQRAQYNQELSDLVQKQSDMERRKLQLEAERQEIQRKKQEISIRLGQQVLEI 286
            |.|.|:|.|:.:...|.:..:|:.:        |.||: :|....:.||::..::     :|.|.
Human   241 MRRYIEEFQKEQALWRKKKREEMEE--------ENRKI-IEFANMQQQREEDRMA-----KVQEN 291

  Fly   287 ENKKRHRDNLLLDLLEAEYTAKSD-ERYRQQMQQEQMS---RQRTRQELDRYRQEVKHRKMAEM- 346
            |.|:....|.|...||.....:.| |:.||::.||:.:   :.:.::|.::     |.||..|| 
Human   292 EEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKLKEEAEK-----KLRKQKEMK 351

  Fly   347 -----QMKRAEM---ATRQEE------------APDTIN-QNSEKQ-LDEYRRRRAHGASLLAMI 389
                 ||...|:   |.::||            ..|.|. .|::|| :.:...|||    :..:|
Human   352 QDFEEQMALKELVLQAAKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRA----VEKLI 412

  Fly   390 EDNHRKRAEATAENVQYFDMKAKIDAEQEERIKQERLAMLSQVPSSVLRYLPKHVLKSTD 449
            |:..::........::.:.::.:........|::|||.:|.:..:::|.||||.|.|..|
Human   413 EERRQQFLADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKED 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 86/375 (23%)
MNS1NP_060835.1 TPH 117..462 CDD:290579 86/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JVC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D449210at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130109
Panther 1 1.100 LDO PTHR19265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.