DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7352 and Mns1

Sequence 1:NP_649795.1 Gene:CG7352 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_032639.1 Gene:Mns1 MGIID:107933 Length:491 Species:Mus musculus

Alignment Length:440 Identity:114/441 (26%)
Similarity:227/441 (51%) Gaps:64/441 (15%)


  Fly    43 KLQYDLEEVSRSQELSKVSPITRDFIEEAAMTQEMQDLKRAEFVERKRRQQLRRDCEELRDLAEQ 107
            :.:.|:||..:..|.:|:.. .|...:|..:..|:..||.....::|.|||:|.:..|||:|.::
Mouse    64 QFELDMEEAIQKAEANKMLR-DRQLEQEERLANELARLKHESLKDKKMRQQVRENSIELRELEQK 127

  Fly   108 LRLAAISRDIAENLEEKKRRRQLDIKLEAAEVSQERCLLEVRQR-EKEVALKEEQRRLRES---- 167
            |:.|.::::.|..:.||...:...:|.: ||:  ||.::|...| .||.:.|:|:|....:    
Mouse   128 LKAAYMNKERAAQIVEKDAMKYEQMKRD-AEI--ERIMMEEHDRLLKEESAKQERRNKERAQYYL 189

  Fly   168 -LAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDRAQELEAQRKKLQKRQDMLRSIKENQE 231
             |.:|:|:..||:.:.:.|::.::.:...:.::|.|||:.:    :::||:|:..:.:.|:|.|.
Mouse   190 DLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVE----RQQKLEKKNAIQKYIEEFQR 250

  Fly   232 LREWQRAQYNQELSDLVQKQSDMERRKLQLEAERQEIQRKKQEISIRLGQQVLEIENKKRHRDNL 296
            .:::.|.:..:|:.:        |.||:...|..|| ||:.:.::     :|.|||.|:..|.||
Mouse   251 AQDFWRQKKREEMEE--------ENRKIIEFANIQE-QREGERMA-----RVHEIEEKRVQRQNL 301

  Fly   297 LLDLLEAEYTAKSD-ERYRQQMQQEQMS---RQRTRQELD-RYRQEVKHRKMAEMQMKRAEM--- 353
            |:..||.....:.| |:.||::.||:.:   :.:.::|.: |.|::.:.::..|.||...|:   
Mouse   302 LMKQLEETLRQRDDLEQVRQELYQEEQAEIIKLKVKEEAELRLRRQREMKQDFEDQMALKELILQ 366

  Fly   354 ATRQEE------------APDTIN-QNSEKQLDEYRRRRAHGASLLAMIEDNHRKRAEATAENVQ 405
            |.::||            ..|.|. .|::||   ..::..|..::..:||:   :|::..|:..:
Mouse   367 AAKEEEETFKKAMLAKFAEDDRIELMNAQKQ---RMKQLEHKRAVEKLIEE---RRSQFLADKQR 425

  Fly   406 YFDMKAKIDAEQ------EERIKQERLAMLSQVPSSVLRYLPKHVLKSTD 449
            ..:   ::..:|      .|.|::|||.:|.:..:.:|.||||.|.|..|
Mouse   426 ELE---ELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKRED 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 92/375 (25%)
Mns1NP_032639.1 TPH 117..462 CDD:290579 92/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JVC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130109
Panther 1 1.100 LDO PTHR19265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.