DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7352 and mns1

Sequence 1:NP_649795.1 Gene:CG7352 FlyBaseID:FBgn0037581 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001096482.1 Gene:mns1 XenbaseID:XB-GENE-1008457 Length:498 Species:Xenopus tropicalis

Alignment Length:474 Identity:118/475 (25%)
Similarity:213/475 (45%) Gaps:89/475 (19%)


  Fly    24 QVPHSLRKEHDFFSSQLFRKLQYDLEEVSRSQELSKVSPITRDFIE-----EAAMTQEMQDLKRA 83
            |:..||:.|......:..::||.: |...|..|..::...:|...|     |..|..||..:|..
 Frog    39 QMAESLKSEERVEKKRFLQRLQNE-EHEKRMDEAIQLGEESRRLKERQLEQEERMALEMARIKHE 102

  Fly    84 EFVERKRRQQLRRDCEELRDLAEQLRLAAISRDIAENLEEKK--RRRQLDIKLEAAEVSQERCLL 146
            :..:.|.|||:|.:..|||:|.::|:.|.::|:.|..:.||:  :..|:...||.....|:.   
 Frog   103 KLKDEKIRQQIRENSTELRELEQKLKAAYLNRERAAQIAEKEVLKYEQMKEDLETVRKMQKD--- 164

  Fly   147 EVRQREKEVALKEEQRRLRE------SLAEQMEENRRRRLQEHAQVMNDRELSLLMQKQIQEEDR 205
              ::|.::..:..|.:|.:|      .|..|:||..:.|.:.:.:.:.::.|...:.::|.||| 
 Frog   165 --QERAEDEEIVRETKRYQEKLNYQIELERQLEEKEKTRQEAYHEFLKEKILIDEIVRKIYEED- 226

  Fly   206 AQELEAQRKKLQKRQDMLRSIKENQELREWQRAQYNQELSDLVQKQSDMERRKLQLEAERQEIQR 270
              ::|.| .||:|.....|.|   :|.:|.|:...|.|     |.:.:.|.||:...|..|  ||
 Frog   227 --QMETQ-LKLEKMNATRRYI---EEFKEQQQTWRNME-----QTRMEEENRKILAFANMQ--QR 278

  Fly   271 KKQEISIRLGQQVLEIENKKRHRDNLLLDLLEAEYTAKSDERYRQQMQQEQMSRQRTRQELDRYR 335
            ::::   |:. :|.|.|.:|:.....|.:.::           ::|.|:|::.:.|....|:...
 Frog   279 REED---RMA-EVREREQQKKALQEKLAEQIQ-----------KEQQQREELEQMREELYLEEQA 328

  Fly   336 QEVKHRKMAEMQMK---RAEMATRQEEAPDTINQNSEKQLDEYRRRRAHGASLLAMI----EDN- 392
            :|.:.:.::||:.|   |.||....||      |.:.||:.:...:....|.:.||:    ||: 
 Frog   329 EEARQKAISEMEKKIRQRLEMQQTFEE------QMAFKQIVQQAAKEEEEAFVQAMLAKFAEDDR 387

  Fly   393 ---------------HRKRAE-ATAENVQYF--DMKAKIDAEQEER---------IKQERLAMLS 430
                           |::..| ...|..|.|  |.:.::...|||.         |::||..:|.
 Frog   388 IEQMNAQKRRMKQLEHKRAVEKLLEERRQQFIADKERELQERQEEERRESFRRAIIEEERQKILK 452

  Fly   431 QVPSSVLRYLPKHVLKSTD 449
            |..:.:|.||||.:.|..|
 Frog   453 QHATQLLGYLPKGIFKGED 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7352NP_649795.1 TPH 97..439 CDD:290579 91/385 (24%)
mns1NP_001096482.1 Borrelia_P83 <24..>183 CDD:114011 39/150 (26%)
TPH 113..464 CDD:316391 95/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JVC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D449210at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.