DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arf102F

DIOPT Version :8

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001259087.1 Gene:Arf102F / 43823 FlyBaseID:FBgn0013749 Length:180 Species:Drosophila melanogaster

Alignment Length:167 Identity:78/168 (46%)
Similarity:112/168 (67%) Gaps:2/168 (1%)


  Fly    14 EREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYW 77
            :::||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:......:||||||..:|..|
  Fly    15 KKQMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNICFTVWDVGGQDKIRPLW 78

  Fly    78 RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEIL 142
            |:||::|.||::||||.||.|:....:|||.:|||:.|..|.|||..||||||.|:::.|:.:.|
  Fly    79 RHYFQNTQGLIFVVDSNDRDRITEAERELQNMLQEDELRDAVLLVFANKQDLPNAMTAAELTDKL 143

  Fly   143 HLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179
            .|..:...||.:....|..|..|...:|||.|::||:
  Fly   144 RLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 76/162 (47%)
Arf102FNP_001259087.1 P-loop_NTPase 1..180 CDD:304359 78/166 (47%)
SAR 15..174 CDD:197556 75/160 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8798337
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.