DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl11

DIOPT Version :8

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_955987.1 Gene:arl11 / 324689 ZFINID:ZDB-GENE-030131-3410 Length:176 Species:Danio rerio

Alignment Length:156 Identity:61/157 (39%)
Similarity:99/157 (63%) Gaps:3/157 (2%)


  Fly     9 KMRQKEREMRILLLGLDNAGKTTIL-KRFNGEPIDTISPTLGFNIKTLEHNGYT-LNMWDVGGQK 71
            |.::.::..::|::|||:|||:|:: ::.:|..:.| |||:|||:.||:.|..| |.:||:|||.
Zfish     5 KSKRFKKPPQVLIMGLDSAGKSTLMYRQLHGVIMQT-SPTVGFNVATLQLNKKTSLTVWDIGGQD 68

  Fly    72 SLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSN 136
            ::|..|:.|.|....||:||||:|..|:....:.|:.:|.:|.|.|..|:||.||:|||..::..
Zfish    69 TMRPNWKYYLEGCKVLVFVVDSSDYARIGEAQKALKKILHDEHLKGVPLMVLANKKDLPNTMTIR 133

  Fly   137 EIKEILHLEDITTHHWLVAGVSAVTG 162
            |:...|.|:..|...|.:...|||.|
Zfish   134 EVSTKLDLDTYTDRQWEIQACSAVKG 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 61/157 (39%)
arl11NP_955987.1 small_GTP 12..166 CDD:272973 60/150 (40%)
ARLTS1 14..172 CDD:133356 60/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.