DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and Arl11

DIOPT Version :8

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_796311.2 Gene:Arl11 / 219144 MGIID:2444054 Length:176 Species:Mus musculus

Alignment Length:165 Identity:71/166 (43%)
Similarity:107/166 (64%) Gaps:3/166 (2%)


  Fly    11 RQKEREMRILLLGLDNAGKTTILKRFNG-EPIDTISPTLGFNIKTLEHNGY-TLNMWDVGGQKSL 73
            |..:.|.:::::|||:|||||||.:..| :.:||: ||:|||::.||..|: :|.:||:|||..|
Mouse     7 RGHKAEAQVVMMGLDSAGKTTILYKLKGNQLVDTL-PTVGFNVEPLEAPGHVSLTLWDIGGQTQL 70

  Fly    74 RSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEI 138
            |:.|::|.|..|.||:|:||.|..||.....||:.:|::..:||...|||.|||:.||||...||
Mouse    71 RATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLEI 135

  Fly   139 KEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLI 173
            :..|.||....|.|.:...||:||:.|..::..|:
Mouse   136 RNRLGLEGFQKHCWELRACSALTGQGLQEALQSLL 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 71/166 (43%)
Arl11NP_796311.2 P-loop_NTPase 14..169 CDD:304359 68/156 (44%)
Ras 15..174 CDD:278499 69/158 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.