DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl-6

DIOPT Version :8

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_497993.1 Gene:arl-6 / 183311 WormBaseID:WBGene00000193 Length:190 Species:Caenorhabditis elegans

Alignment Length:183 Identity:59/184 (32%)
Similarity:106/184 (58%) Gaps:5/184 (3%)


  Fly     1 MGFLTVLKKM-RQKEREMRILLLGLDNAGKTTILKRFNGEPI--DTISPTLGFNIKTLEHNGYTL 62
            |||.:.|..: ...::::.|:::||||:||||||.:......  ..|.||:|..:........:.
 Worm     1 MGFFSSLSSLFGLGKKDVNIVVVGLDNSGKTTILNQLKTPETRSQQIVPTVGHVVTNFSTQNLSF 65

  Fly    63 NMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLA--GATLLVLCN 125
            :.:|:.||...||.|.:||.|:.|:::|:||:||:|:|....||.::::.:.:.  |..:::|.|
 Worm    66 HAFDMAGQMKYRSTWESYFHSSQGVIFVLDSSDRLRMELLKDELMMVMEHKDVVSRGIPIVILAN 130

  Fly   126 KQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAK 178
            |.|:|||:::::|...|.|....:..|.:....|:||:.|..:|..|.|:|.|
 Worm   131 KMDIPGAMTASDITVALGLNLYRSGTWSIHSTCALTGDGLDKAMQQLSAEITK 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 55/177 (31%)
arl-6NP_497993.1 small_GTP 17..173 CDD:272973 50/156 (32%)
Arl6 19..180 CDD:206722 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.