DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl2 and arl11

DIOPT Version :8

Sequence 1:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_002935781.1 Gene:arl11 / 100490310 XenbaseID:XB-GENE-1012125 Length:180 Species:Xenopus tropicalis

Alignment Length:168 Identity:67/169 (40%)
Similarity:102/169 (60%) Gaps:2/169 (1%)


  Fly    14 EREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLE-HNGYTLNMWDVGGQKSLRSYW 77
            :::.|::::|||.:||:|||.:.....:....||:|||::.:| ....::.:||||||..||..|
 Frog    11 KKQPRVVMMGLDYSGKSTILYKLKINQLVETFPTVGFNVEHIEMSKNVSVTVWDVGGQDKLRPNW 75

  Fly    78 RNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEIL 142
            :.|.|.||.|::||||:|..||.....||..:|..|.:||...|:|.||||:..||.:.|:|.||
 Frog    76 KEYLEDTDVLIFVVDSSDPDRLPDATAELLSILNNENMAGVPFLILANKQDITDALPAKELKHIL 140

  Fly   143 HLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKRI 180
            .||:.....|.:...||.|||.|..:|: .:|.:.||:
 Frog   141 KLENYDDRPWEIQSCSAYTGEGLAEAMN-AVASLLKRV 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Arl2NP_476886.1 Arl2 3..175 CDD:206720 65/162 (40%)
arl11XP_002935781.1 P-loop_NTPase 15..173 CDD:304359 65/159 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.