DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and sv

DIOPT Version :9

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster


Alignment Length:246 Identity:111/246 - (45%)
Similarity:144/246 - (58%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPG 74
            :|.|||||||||||||||:..|.||||||..|:||||||||||||||||||||:||:||||...|
  Fly   176 HGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYETGSFKAG 240

  Fly    75 AIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSL 139
            .||||||:|.||.||:.|...|:.:|.:||||||||||:|.||.:.||||||||:||:|||....
  Fly   241 VIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKAAEK 305

  Fly   140 G---HQHTPGTVMGSGSSSGGGSVSSNG-GQNNGT----------SASNNINLSNLGNPGGGPHH 190
            .   |.|....|   ..|.|||.:::.. ..:.||          |::|::|             
  Fly   306 AKHVHHHQQHHV---SQSLGGGHIATESVDSSTGTIGEPQPPTSNSSANSVN------------- 354

  Fly   191 PHHHHHHQSAAAAASAH----------------HVHAHAHAHAHLYNSIYQ 225
                   .:.:|:||.|                |::|:::...|:.::..|
  Fly   355 -------TNVSASASVHASIPTSGTDSVQVSVGHINANSNETTHINSTAEQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645 88/122 (72%)
svNP_524633.3 PAX 175..299 CDD:128645 88/122 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.