DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Poxm and CG11294

DIOPT Version :10

Sequence 1:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_572500.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:129 Identity:36/129 - (27%)
Similarity:48/129 - (37%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SLGHQHTPGTVMGSGSSSGGGSVSSNGG--------QNNGTSASNNINLSNLGN-PGGGPH---H 190
            |||   || .|||.|:..||   |.||.        ..|.:|||.:..|:.:|| |..|..   |
  Fly    98 SLG---TP-PVMGGGAVQGG---SGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGSFTMMH 155

  Fly   191 PHHHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSV 254
            |.....||      ...|   ..|..|...:.:.:.|:....|.      :||.....||..::
  Fly   156 PAFQQQHQ------QQQH---QGHQQATDQDKLSKTYTELKLYK------APSHGMELGGMAAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PoxmNP_001036687.1 PAX 10..133 CDD:128645
CG11294NP_572500.1 Homeodomain 29..81 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.