DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq2 and Coq2

DIOPT Version :8

Sequence 1:NP_649789.1 Gene:Coq2 / 40988 FlyBaseID:FBgn0037574 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001037720.1 Gene:Coq2 / 498332 RGDID:1306722 Length:374 Species:Rattus norvegicus

Alignment Length:299 Identity:192/300 (64%)
Similarity:228/300 (76%) Gaps:9/300 (3%)


  Fly    69 PLQELVSAAKPYAQLMRIDRPIGTYLLFWPCAWSIALSADAGCWPDLTMLGLFGTGALIMRGAGC 133
            |||       ||.:|||:|:||||:||:.||.|||.|:||.||:||..||.||||||::||||||
  Rat    70 PLQ-------PYLRLMRLDKPIGTWLLYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGC 127

  Fly   134 TINDLWDKDIDAKVERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQSILLGASSLGLV 198
            ||||:||:|.|.|||||..||:|:|.||.|.:.|||.|||:|.|.||:.||:.||.:||:||.||
  Rat   128 TINDMWDRDFDKKVERTANRPIAAGDISAFQSFVFLGAQLTLALGVLLHLNYYSIAMGAASLLLV 192

  Fly   199 ITYPLMKRVTYWPQLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGVCWTIVYDTIYAHQDKL 263
            :|||||||||:||||.||:.|||||||||.|.:||.:.|.|||||.|||.||::||||||||||.
  Rat   193 VTYPLMKRVTFWPQLALGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKK 257

  Fly   264 DDLQIGVKSTALRFGENTKVWLSGFTAAMLTGLSAAGWACDQTVPYYAAVGVVGAHLVQQIYSLN 328
            ||..||:|||||.|.||||.|||||..||:..||..|.:..||:||||||..|||||..|||:::
  Rat   258 DDALIGLKSTALLFRENTKQWLSGFGVAMVGALSLVGASSGQTLPYYAAVAAVGAHLAHQIYTVD 322

  Fly   329 IDNPSDCAKKFISNHQVGLILFLGIVLGTLLKS--DESK 365
            |....||.:||.||..|||:||||||||.|.|.  ||:|
  Rat   323 IHRAEDCWEKFTSNRTVGLLLFLGIVLGNLYKDKPDETK 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq2NP_649789.1 PT_UbiA 73..358 CDD:294241 184/285 (65%)
Coq2NP_001037720.1 PT_UbiA 68..353 CDD:294241 182/283 (64%)
Allylic polyprenyl diphosphate-binding site. {ECO:0000255|HAMAP-Rule:MF_03189} 122..144 18/22 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257500301
eggNOG 1 0.900 E1_COG0382
Hieranoid 1 1.000
Homologene 1 1.000 H69192
Inparanoid 1 1.050 390 1.000 Inparanoid score I1897
OMA 1 1.010
OrthoDB 1 1.010 D1343847at2759
OrthoFinder 1 1.000 FOG0004100
OrthoInspector 1 1.000 T1087805
orthoMCL 1 0.900 OOG5_127332
Panther 1 1.100 LDO PTHR11048
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.