DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq2 and coq-2

DIOPT Version :8

Sequence 1:NP_649789.1 Gene:Coq2 / 40988 FlyBaseID:FBgn0037574 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_498513.2 Gene:coq-2 / 175969 WormBaseID:WBGene00000762 Length:370 Species:Caenorhabditis elegans

Alignment Length:356 Identity:180/357 (50%)
Similarity:232/357 (65%) Gaps:23/357 (6%)


  Fly    17 SSYAAAATTKHMLPRQPARVLIGDWSTWDKSRLQDVCSRSSSTATEPVKQQTPLQELVSAAKPYA 81
            :||:...:||..:            ||..|..:..:.:.||..|:.|..           .|||.
 Worm    25 TSYSLDESTKRWI------------STSTKQPMSLIPTASSLVASSPPN-----------LKPYL 66

  Fly    82 QLMRIDRPIGTYLLFWPCAWSIALSADAGCWPDLTMLGLFGTGALIMRGAGCTINDLWDKDIDAK 146
            ||||:|:||||:||:|||.||||::..||..|.:.||.|||.||.:||.|||.||||||||.|.|
 Worm    67 QLMRVDKPIGTWLLYWPCTWSIAMATPAGQLPSIYMLSLFGAGAFLMRSAGCVINDLWDKDFDKK 131

  Fly   147 VERTRLRPLASGQISQFDAIVFLSAQLSLGLLVLVQLNWQSILLGASSLGLVITYPLMKRVTYWP 211
            ||||:|||||.|.:::..||..|:..||..|.:|:||||.|:.:||||:.||:.|||.||.||||
 Worm   132 VERTKLRPLACGSLTEKQAIGLLAGLLSSSLAILLQLNWYSVAVGASSMALVVGYPLAKRFTYWP 196

  Fly   212 QLVLGMAFNWGALLGWCATQGSVNLAACLPLYLSGVCWTIVYDTIYAHQDKLDDLQIGVKSTALR 276
            |.|||:.|||||||||||.:|.::.:|...:|.:.:.||::||||||||||.||:.|||||||||
 Worm   197 QFVLGLTFNWGALLGWCALKGDLSSSAPFWMYAAALQWTLIYDTIYAHQDKADDIMIGVKSTALR 261

  Fly   277 FGENTKVWLSGFTAAMLTGLSAAGWACDQTVPYYAAVGVVGAHLVQQIYSLNIDNPSDCAKKFIS 341
            .|.:||.|||.|....:..|:|.|.|.|||.|||.|:....|.|..|:.:::|||.|||..||.|
 Worm   262 LGADTKKWLSAFGVGTVASLTACGIASDQTWPYYVALAATTAQLGWQVGTVDIDNGSDCWDKFKS 326

  Fly   342 NHQVGLILFLGIVLGTLLKSDESKKQRQSSL 372
            |..:|:|||.|||..||||.||..|:.:.::
 Worm   327 NSWMGIILFSGIVASTLLKEDEKTKESRKNI 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq2NP_649789.1 PT_UbiA 73..358 CDD:294241 163/285 (57%)
coq-2NP_498513.2 PT_UbiA 59..343 CDD:294241 164/295 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257486421
eggNOG 1 0.900 E1_COG0382
Hieranoid 1 1.000
Homologene 1 1.000 H69192
Inparanoid 1 1.050 351 1.000 Inparanoid score I1329
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1343847at2759
OrthoFinder 1 1.000 FOG0004100
OrthoInspector 1 1.000 T477513
orthoMCL 1 0.900 OOG5_127332
Panther 1 1.100 LDO PTHR11048
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R232
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.