| Sequence 1: | NP_649787.2 | Gene: | CG11698 / 40986 | FlyBaseID: | FBgn0037572 | Length: | 262 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097348.1 | Gene: | CG34459 / 5740101 | FlyBaseID: | FBgn0085488 | Length: | 305 | Species: | Drosophila melanogaster | 
| Alignment Length: | 219 | Identity: | 76/219 - (34%) | 
|---|---|---|---|
| Similarity: | 115/219 - (52%) | Gaps: | 27/219 - (12%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    26 TAAHPAQRN---------DPRFK--------PGSLPCKTSMKASQVASKAAKDAKDAKDAQPCAA 73 
  Fly    74 EMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAI---AASSCSAT 135 
  Fly   136 SAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEA 200 
  Fly   201 QKDLERNKQSAKKANDAAKEAQQR 224 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG11698 | NP_649787.2 | DUF745 | 45..225 | CDD:283087 | 67/183 (37%) | 
| CG34459 | NP_001097348.1 | DUF745 | 115..295 | CDD:283087 | 68/187 (36%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2CCAW | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0007622 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR37161 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.910 | |||||