DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11698 and CG14354

Sequence 1:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster

Alignment Length:174 Identity:58/175 (33%)
Similarity:94/175 (54%) Gaps:0/175 (0%)


  Fly    51 ASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAE 115
            ||.:|.|||::||.|.|.|..||..|..:.:..||::|:.|||||||||.||:||:::....:.|
  Fly    65 ASNIAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGKQQLMEQLQDEVHE 129

  Fly   116 TNRVIEEIQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKR 180
            ...:::|...::..|..:...|.....:..|.:..::|.:|.....:.|....|..||:|..||.
  Fly   130 AEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAASGAQQELCEKN 194

  Fly   181 SLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKEAQQR 224
            .|::.||.|.|.|...:..|:.|....:::|.:|..||.||:.:
  Fly   195 QLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANEARNK 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 58/175 (33%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 58/175 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.