DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11698 and CG14841

Sequence 1:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650350.1 Gene:CG14841 FlyBaseID:FBgn0038218 Length:274 Species:Drosophila melanogaster

Alignment Length:238 Identity:79/239 (33%)
Similarity:131/239 (55%) Gaps:16/239 (7%)


  Fly    12 SLVTMLLLSNILLSTAAHPAQRNDPRFKPGSLP-CKTS---------------MKASQVASKAAK 60
            |.:.|:..|:.:::....||.........||.. |:||               .|||.:|.|||:
  Fly    31 SHIIMISDSDPVVARLYEPASEKKQTASGGSSEGCETSSAVQNSCGLSQKNAKSKASSIAIKAAQ 95

  Fly    61 DAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQR 125
            |||.|.|||..|.|.|..:.::.||::|:|||:||||||.||:|::::......|...|::|::.
  Fly    96 DAKAANDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLELEEKEAVAVVDEVKN 160

  Fly   126 AIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKAARMRV 190
            ::.::..:|.||.....:....::.:|.:|.|....:.||...|:.||.|..||..||:||..||
  Fly   161 SLHSTQVNAESAMLAFSEAKIQLDQLKVLLAEATAQMTNIETFANGAQLEMDEKGQLLEAANRRV 225

  Fly   191 EELHSCMCEAQKDLERNKQSAKKANDAAKEAQQRIEALQKLVS 233
            |.:...:..|::|.::.|::|.||..||.||:|:.:.:|:.:|
  Fly   226 ESISRQVVAARQDYDKTKKAAYKAACAAVEAKQKAQRMQRAIS 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 70/195 (36%)
CG14841NP_650350.1 DUF745 81..260 CDD:283087 67/179 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.