DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11698 and CG14840

Sequence 1:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650349.1 Gene:CG14840 FlyBaseID:FBgn0038217 Length:300 Species:Drosophila melanogaster

Alignment Length:202 Identity:74/203 (36%)
Similarity:119/203 (59%) Gaps:11/203 (5%)


  Fly    33 RNDPRFKPGSLPCKTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEA 97
            |.||:           .|||.:|.|||::||.|.|:|..|||.|..:.:..||.:|.|:|:||||
  Fly    81 RGDPK-----------QKASNIAQKAAQEAKAASDSQMAAAEAAASQVKNELAAKAAQSARAAEA 134

  Fly    98 ALNGKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGGNL 162
            ||.||:|::::..:.:.|.:.|:.|:..::..:..:|.:|.....:..:.:|.:|:::.....||
  Fly   135 ALAGKQQIVEQLQQEMTEADAVVTEVTSSLQNTQANANAAASAAHEAQSQLNQLKNLVIAATSNL 199

  Fly   163 DNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKEAQQRIEA 227
            .||..:|..||:|..||..||:||:.|||.|...|.||:.|.|:.||:|.||..||.||:|:.:.
  Fly   200 ANIENVASGAQQELAEKTQLLEAAKHRVENLTRQMTEAKTDFEKTKQAAYKAACAAVEAKQKAQR 264

  Fly   228 LQKLVSR 234
            .:::..|
  Fly   265 SRRMTHR 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 70/180 (39%)
CG14840NP_650349.1 DUF745 82..262 CDD:283087 72/191 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.