DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11698 and CG11694

DIOPT Version :9

Sequence 1:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 / 40985 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster


Alignment Length:226 Identity:80/226 - (35%)
Similarity:125/226 - (55%) Gaps:24/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GSLPC------KTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAAL 99
            |..||      ||.:|||.:|.||||:|.:|.|||..|.|.|..:.::.|||:||.|||||||||
  Fly    50 GGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLADKALAAAKAAEAAL 114

  Fly   100 NGKKQLLDEYTKSLAETNRVIEE----IQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGG 160
            .||:|::::....:.|...|::|    :|......:.:..:||...|:|    |.:...:|....
  Fly   115 AGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQL----NTITLAVKNAQD 175

  Fly   161 NLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKEAQQRI 225
            |:.|...:|..||:|..||:.|::||:.|||.|...:..|:.|.:..|.:|:||..||:||:.| 
  Fly   176 NVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQEARHR- 239

  Fly   226 EALQKLVSRIKMLKRKDLQSLENFLRRRRSS 256
                    ..:..:|.:|:.| .:|:|.|::
  Fly   240 --------ATRERRRAELRHL-LWLKRGRTN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 71/189 (38%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 21/44 (48%)
DUF745 60..223 CDD:283087 62/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007622
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.