DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11698 and CG11694

Sequence 1:NP_649787.2 Gene:CG11698 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649786.1 Gene:CG11694 FlyBaseID:FBgn0037571 Length:261 Species:Drosophila melanogaster

Alignment Length:226 Identity:80/227 (35%)
Similarity:125/227 (55%) Gaps:24/227 (11%)


  Fly    41 GSLPC------KTSMKASQVASKAAKDAKDAKDAQPCAAEMAGYRAREMLADRALQAAKAAEAAL 99
            |..||      ||.:|||.:|.||||:|.:|.|||..|.|.|..:.::.|||:||.|||||||||
  Fly    50 GGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLADKALAAAKAAEAAL 114

  Fly   100 NGKKQLLDEYTKSLAETNRVIEE----IQRAIAASSCSATSAKGIRDKLCTSVNIMKSMLKEMGG 160
            .||:|::::....:.|...|::|    :|......:.:..:||...|:|    |.:...:|....
  Fly   115 AGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYAAAGQAAKQAADQL----NTITLAVKNAQD 175

  Fly   161 NLDNIRRMADSAQKEALEKRSLLKAARMRVEELHSCMCEAQKDLERNKQSAKKANDAAKEAQQRI 225
            |:.|...:|..||:|..||:.|::||:.|||.|...:..|:.|.:..|.:|:||..||:||:.| 
  Fly   176 NVVNSEHVASGAQQELGEKQQLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQEARHR- 239

  Fly   226 EALQKLVSRIKMLKRKDLQSLENFLRRRRSS 256
                    ..:..:|.:|:.| .:|:|.|::
  Fly   240 --------ATRERRRAELRHL-LWLKRGRTN 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 72/190 (38%)
CG11694NP_649786.1 Ribosomal_S11 34..>95 CDD:294237 21/45 (47%)
DUF745 60..223 CDD:283087 62/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CCAW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.