DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11698 and CG33257

DIOPT Version :9

Sequence 1:NP_649787.2 Gene:CG11698 / 40986 FlyBaseID:FBgn0037572 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:276 Identity:67/276 - (24%)
Similarity:110/276 - (39%) Gaps:65/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYDARFPMRCDSLVTMLLLSNILLSTAAHPAQRNDPRFKPGSLP--------------------- 44
            ||..........||.:|||||.|    ....:||...::|...|                     
  Fly     1 MYGQGLRFLLAQLVLVLLLSNAL----GRLHKRNGYHYRPQQPPPIHQGGYFEPHLPAVEPPEPE 61

  Fly    45 ---------CKTSMKASQVASK-----------------AAKDAKDAKDAQPCAAEMAGYRAREM 83
                     ..||..:|.|:||                 :|..|..|...|..||:.|.|.|:..
  Fly    62 KPQHSTKSYYTTSGGSSSVSSKGSGGYSIGSGLRSIAQGSADQAHSAVTNQHAAAKQAAYIAQNT 126

  Fly    84 LADRALQAAKAAEAALNGKKQLLDEYTKSLAETNRVIEEIQRAIAASSCSATSAKGIRDKLCTSV 148
            ||..|.|||..|:|||.||:.:|.|..:..||..|.:......:.|:..||..|:.........:
  Fly   127 LAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRELEQLKAAKISARLAQQTAQAAHHHI 191

  Fly   149 NIMKSMLKEMGGNLDNIRRMADSAQKEALEKRSLLKA-------ARMRVEELHSCMCEAQKDLER 206
            :::.:.       ::|.:.:|:.|::.:.|..:.|.:       ::.|:|::...:.:|:.|...
  Fly   192 SVLTAA-------VNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKNRLEQVEEQLHQARVDYAA 249

  Fly   207 NKQSAKKANDAAKEAQ 222
            .|:||.||.::|..||
  Fly   250 TKESALKAANSAAAAQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11698NP_649787.2 DUF745 45..225 CDD:283087 53/202 (26%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 39/164 (24%)
SNARE 195..240 CDD:304603 7/51 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.