DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11693 and CG34459

Sequence 1:NP_001246985.1 Gene:CG11693 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001097348.1 Gene:CG34459 FlyBaseID:FBgn0085488 Length:305 Species:Drosophila melanogaster

Alignment Length:278 Identity:70/279 (25%)
Similarity:117/279 (42%) Gaps:42/279 (15%)


  Fly    44 PSPHGPGPVPQQTAVIEHEVPPYTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGGGSG-- 106
            |..|.    ||...:|:.......:.||.    ||...:::. :.|:..|...:.||...|||  
  Fly    27 PQRHS----PQHKRMIDPRELLNDFAAIK----EPGTSEVAP-KNSARSIALYNAGGAMSGSGEG 82

  Fly   107 ---GYLADNGLRS----------------------------IAKGSADQALSAVASQNAAGKQAS 140
               |...||...:                            ||..:|..|.:|..:|:|||:.|:
  Fly    83 TAPGPGTDNSKSASNKQCDPQAKCNVKTIITPGDPKQKSSMIAMKAAQDAKAASEAQSAAGQAAA 147

  Fly   141 YVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENELTQLQQAKRSAKAAQYAAQ 205
            ...|..||:.|.|:|..|.|.|.||::::.:||.:..||...:|.|...:...:.:..||..|.:
  Fly   148 QHIKMELAEKAFQSAKAAEAALMGKQMMVDQLEQEVQEASAVVEEESNSIHHTEANMNAAVEAVK 212

  Fly   206 QAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKTKLEHAESQAYAARLDYEET 270
            .|:.....:......|:.:....|..|..:..|:|::..::..|:.::...:.|..:|..|||:|
  Fly   213 VAVQQFETINELQKTARESLTNIQTVAMGSQQEMAAKTQLLEAARNRMAMLQKQLVSAHDDYEKT 277

  Fly   271 RDAAEKATLSAQEAHLNA 288
            :.||.||..:|.||...|
  Fly   278 KQAAYKAACAAVEAKQRA 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 52/208 (25%)
CG34459NP_001097348.1 DUF745 115..295 CDD:283087 50/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.