DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11693 and CG14354

Sequence 1:NP_001246985.1 Gene:CG11693 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651433.1 Gene:CG14354 FlyBaseID:FBgn0039376 Length:298 Species:Drosophila melanogaster

Alignment Length:228 Identity:65/229 (28%)
Similarity:105/229 (46%) Gaps:24/229 (10%)


  Fly   104 GSGGYLADNGLRSIAKGSADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVL 168
            |:....|.|    ||:.:|.:|..|..:|..|...|:...|..||:.|..||..|.|.|.||:.|
  Fly    59 GNSKQTASN----IAQKAAQEAKKASDTQAPAALAAARQVKHQLAEKAIAAAKAAEAALAGKQQL 119

  Fly   169 LHRLEDQSVEAHKAMENELTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAAS 233
            :.:|:|:..||...::.|...|..::.:...|...|:|....:..|.:::..|:.|...|:.|||
  Fly   120 MEQLQDEVHEAEIIVQEETYSLVGSQTNVNVAVATAKQCQTLLQSLRSSVKVAEEAVSNAEAAAS 184

  Fly   234 EAAAELASQIDMVAQAKTKLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNANDAALHANVE 298
            .|..||..:..:|..|:.:.|....|..:|:|||..||.||.:|..:|.|    |.:.|:.....
  Fly   185 GAQQELCEKNQLVETARQRAEMLMQQLRSAKLDYTNTRKAAYRAACAANE----ARNKAVRDRRS 245

  Fly   299 LAENV---------------HIHDKSDRNVREP 316
            ..|::               |.||:.. |:::|
  Fly   246 YEEDIGGTFGQQQQQQQQMLHNHDQPG-NLQDP 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 56/180 (31%)
CG14354NP_651433.1 DUF745 59..239 CDD:283087 58/188 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.