DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11693 and CG14839

Sequence 1:NP_001246985.1 Gene:CG11693 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_650351.2 Gene:CG14839 FlyBaseID:FBgn0038219 Length:282 Species:Drosophila melanogaster

Alignment Length:237 Identity:70/238 (29%)
Similarity:105/238 (44%) Gaps:31/238 (13%)


  Fly    78 PAKVKLSHFE--------GSSDYIVHSHRGG-GGGGSG-GYLAD---NGLRSIAK-----GSADQ 124
            ||....:|:.        ..|| ::.|..|| ||||.| |.:.|   ....|.||     .:|.|
  Fly    18 PASATGNHYRTRRKPMQTEDSD-LMRSFAGGLGGGGPGDGTVCDMSGEDSNSPAKKTRNHTNAKQ 81

  Fly   125 ALSAVASQNA------------AGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSV 177
            ..|.:|.|.|            |.|:|:...|...|..|..||..|.|||.||..:|.:||.:..
  Fly    82 RSSGIAVQAANEAKKANDDMKNAVKEAADKIKGEYADKANAAAKAAEAVLFGKSQVLEQLEAEVR 146

  Fly   178 EAHKAMENELTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQ 242
            ||...::.|..:|..|:.:|:.|....|.....:..||.:|..|:...:.:.:..:.....||.:
  Fly   147 EAEMVVQEENQELITAESNAQLAAKTHQLVQQELKTLTISLKLAKDIKDASDQVYTVWQQSLADK 211

  Fly   243 IDMVAQAKTKLEHAESQAYAARLDYEETRDAAEKATLSAQEA 284
            ..::..|:.::.....|...|||||::|:.||..|..:||||
  Fly   212 TALLEAAQRRVNVLMRQLSEARLDYDKTKKAALSAAKAAQEA 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 56/198 (28%)
CG14839NP_650351.2 DUF745 77..237 CDD:283087 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR37161
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.