DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11693 and CG33257

DIOPT Version :9

Sequence 1:NP_001246985.1 Gene:CG11693 / 40984 FlyBaseID:FBgn0037570 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_996107.1 Gene:CG33257 / 2768960 FlyBaseID:FBgn0053257 Length:330 Species:Drosophila melanogaster


Alignment Length:335 Identity:137/335 - (40%)
Similarity:183/335 - (54%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LHLLLLALFLVAMPTQ--GRKIKRKEPHYHHHVNVPPPPPPP-------SPHGPGPVPQQTAVIE 60
            |..||..|.||.:.:.  ||..||...||.      |..|||       .||.|...|.:....:
  Fly     6 LRFLLAQLVLVLLLSNALGRLHKRNGYHYR------PQQPPPIHQGGYFEPHLPAVEPPEPEKPQ 64

  Fly    61 HEVPPYTYEAINHDEFEPAKVKLSHFEGSSDYIVHSHRGGGGG----GSGGYLADNGLRSIAKGS 121
            |....|                            ::..||...    |||||...:||||||:||
  Fly    65 HSTKSY----------------------------YTTSGGSSSVSSKGSGGYSIGSGLRSIAQGS 101

  Fly   122 ADQALSAVASQNAAGKQASYVAKSTLAQAAAQAAGTAVAVLKGKEVLLHRLEDQSVEAHKAMENE 186
            ||||.|||.:|:||.|||:|:|::||||||:|||.||.|.|.||:|:|..||.|:.||.:::..|
  Fly   102 ADQAHSAVTNQHAAAKQAAYIAQNTLAQAASQAAATAQAALVGKQVVLQELEQQAAEAQRSLSRE 166

  Fly   187 LTQLQQAKRSAKAAQYAAQQAINHVSVLTAALNNAQSASELAQKAASEAAAELASQIDMVAQAKT 251
            |.||:.||.||:.||..||.|.:|:||||||:|||:|.:|.|::.::|...:||||..||.|:|.
  Fly   167 LEQLKAAKISARLAQQTAQAAHHHISVLTAAVNNAKSVAEQAEQTSTEVNNQLASQSQMVGQSKN 231

  Fly   252 KLEHAESQAYAARLDYEETRDAAEKATLSAQEAHLNANDAALHANVELAE----NVHIHDKSDRN 312
            :||..|.|.:.||:||..|:::|.||..||..|.:||:.||.||.:.|.|    :.|.||..:..
  Fly   232 RLEQVEEQLHQARVDYAATKESALKAANSAAAAQVNASKAAQHATIGLHESTNPSAHGHDGQELG 296

  Fly   313 VREPPRNHRL 322
            ..|...:..|
  Fly   297 GEEESYDEHL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11693NP_001246985.1 DUF745 108..288 CDD:283087 96/179 (54%)
CG33257NP_996107.1 DUF745 94..252 CDD:283087 88/157 (56%)
SNARE 195..240 CDD:304603 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C6CE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016774
OrthoInspector 1 1.000 - - otm50159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.