DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nac and GONST5

DIOPT Version :8

Sequence 1:NP_649782.1 Gene:nac / 40981 FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_173605.1 Gene:GONST5 / 838789 AraportID:AT1G21870 Length:341 Species:Arabidopsis thaliana

Alignment Length:329 Identity:76/330 (23%)
Similarity:146/330 (44%) Gaps:46/330 (14%)


  Fly    25 YWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVASRLSRKYPSVFTFPEGNPLDI 89
            :|..::..:.:||.:...  ::...||.:|....:.|::..::..::.:..|.:...||      
plant    22 WWGFNVTVIIMNKWIFQK--LDFKFPLSVSCVHFICSSIGAYIVIKVLKLKPLIVVDPE------ 78

  Fly    90 DTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSFKCLLCCGA 154
            |.:|:|.|:|.::.:.|...|:||.|:.|:|....:|||...:|||.:::.|:...::.......
plant    79 DRWRRIFPMSFVFCINIVLGNISLRYIPVSFMQTIKSLTPATTVVLQWLVWRKYFDWRIWASLVP 143

  Fly   155 IVVGFWLGVDQESLTE----VFSWRGTIFGVLSSLALAMFSIQTKKSL--GYVNQEVWLLSYYNN 213
            ||.|..|    .|:||    ||.:...:||.|::....:.:    :||  ||....:..:.|...
plant   144 IVGGILL----TSITELSFNVFGFCAALFGCLATSTKTILA----ESLLHGYKFDSINTVYYMAP 200

  Fly   214 LYSTLLFLPLIII--NGELESIITYPHLWASWF------WAAMTL---SGLCGFAIGFVTALEIK 267
            ..:.:|.||..::  ||.|:           ||      |:|:.:   ||:..|.:.|.....|:
plant   201 FATMILGLPAFLLERNGILD-----------WFEAHPSPWSALIILFNSGVLAFCLNFSIFYVIQ 254

  Fly   268 VTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRVKQLEMMRQHQQRST 332
            .|:|:|.|::|..|......::...:.:..|.:......:.||....|..|:  .|:.|.|..:.
plant   255 STTAVTFNVAGNLKVAVAVFVSWMIFRNPISPMNAVGCGITLVGCTFYGYVR--HMLSQQQPGTP 317

  Fly   333 ATQK 336
            .|.:
plant   318 RTPR 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nacNP_649782.1 TPT 16..281 CDD:281186 66/273 (24%)
GONST5NP_173605.1 TPT 22..303 CDD:281186 71/308 (23%)
EamA 28..153 CDD:279264 33/137 (24%)
EamA 161..301 CDD:304911 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.